Recombinant Human CHN2 protein, His-tagged

• Cat.No.: CHN2-6745H
• Product Overview: Recombinant Human CHN2 protein(155-215 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 155-215 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: HIGYATLLREKVSRRLSRSKNEPRKTNVTHEEHTAVEKISSLVRRAALTHNDNHFNYEKTH
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: CHN2 chimerin (chimaerin) 2 [ Homo sapiens ]
• Official Symbol: CHN2
• Synonyms: CHN2; chimerin (chimaerin) 2; beta-chimaerin; ARHGAP3; beta chimerin; RhoGAP3; beta-chimerin; beta3-chimaerin; rho-GTPase-activating protein 3; BCH; CHN2-3; RHOGAP3; MGC138360
• Gene ID: 1124
• mRNA Refseq: NM_001039936
• Protein Refseq: NP_001035025
• MIM: 602857
• UniProt ID: P52757