Recombinant Human CHN2 protein, His-tagged
| Cat.No. : | CHN2-6745H |
| Product Overview : | Recombinant Human CHN2 protein(155-215 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 155-215 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | HIGYATLLREKVSRRLSRSKNEPRKTNVTHEEHTAVEKISSLVRRAALTHNDNHFNYEKTH |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | CHN2 chimerin (chimaerin) 2 [ Homo sapiens ] |
| Official Symbol | CHN2 |
| Synonyms | CHN2; chimerin (chimaerin) 2; beta-chimaerin; ARHGAP3; beta chimerin; RhoGAP3; beta-chimerin; beta3-chimaerin; rho-GTPase-activating protein 3; BCH; CHN2-3; RHOGAP3; MGC138360; |
| Gene ID | 1124 |
| mRNA Refseq | NM_001039936 |
| Protein Refseq | NP_001035025 |
| MIM | 602857 |
| UniProt ID | P52757 |
| ◆ Recombinant Proteins | ||
| CHN2-6745H | Recombinant Human CHN2 protein, His-tagged | +Inquiry |
| CHN2-853R | Recombinant Rhesus monkey CHN2 Protein, His-tagged | +Inquiry |
| CHN2-1486H | Recombinant Human CHN2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CHN2-6746H | Recombinant Human CHN2 protein, His-tagged | +Inquiry |
| CHN2-1379R | Recombinant Rat CHN2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CHN2-7528HCL | Recombinant Human CHN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHN2 Products
Required fields are marked with *
My Review for All CHN2 Products
Required fields are marked with *



