Recombinant Human CHP Protein, GST-Tagged
Cat.No. : | CHP-1261H |
Product Overview : | Human CHP full-length ORF (AAH08373, 1 a.a. - 66 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a phosphoprotein that binds to the Na+/H+ exchanger NHE1. This protein serves as an essential cofactor which supports the physiological activity of NHE family members and may play a role in the mitogenic regulation of NHE1. The protein shares similarity with calcineurin B and calmodulin and it is also known to be an endogenous inhibitor of calcineurin activity. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 33 kDa |
AA Sequence : | MESHSVTQAGVQWRDLGSLQPLPPGFKQFSHLSLPSSWDYRRVPPYLGNFCIFSGEGVSPCWPGWS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHP calcium binding protein P22 [ Homo sapiens ] |
Official Symbol | CHP |
Synonyms | CHP; calcium binding protein P22; calcium-binding protein p22; calcineurin B homolog; SLC9A1 binding protein; calcium-binding protein CHP; calcineurin homologous protein; SLC9A1BP; FLJ20350; |
Gene ID | 11261 |
mRNA Refseq | NM_007236 |
Protein Refseq | NP_009167 |
MIM | 606988 |
◆ Recombinant Proteins | ||
CHP-3214HF | Recombinant Full Length Human CHP Protein, GST-tagged | +Inquiry |
CHP-11197H | Recombinant Human CHP, GST-tagged | +Inquiry |
CHP-2168S | Recombinant Staphylococcus Aureus CHP Protein (29-149 aa), His-tagged | +Inquiry |
CHP-1039R | Recombinant Rat CHP Protein, His (Fc)-Avi-tagged | +Inquiry |
chp-1111S | Recombinant Staphylococcus aureus chp protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHP-7527HCL | Recombinant Human CHP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHP Products
Required fields are marked with *
My Review for All CHP Products
Required fields are marked with *