Recombinant Human CHP Protein, GST-Tagged

Cat.No. : CHP-1261H
Product Overview : Human CHP full-length ORF (AAH08373, 1 a.a. - 66 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a phosphoprotein that binds to the Na+/H+ exchanger NHE1. This protein serves as an essential cofactor which supports the physiological activity of NHE family members and may play a role in the mitogenic regulation of NHE1. The protein shares similarity with calcineurin B and calmodulin and it is also known to be an endogenous inhibitor of calcineurin activity. [provided by RefSeq, Jul 2008]
Molecular Mass : 33 kDa
AA Sequence : MESHSVTQAGVQWRDLGSLQPLPPGFKQFSHLSLPSSWDYRRVPPYLGNFCIFSGEGVSPCWPGWS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CHP calcium binding protein P22 [ Homo sapiens ]
Official Symbol CHP
Synonyms CHP; calcium binding protein P22; calcium-binding protein p22; calcineurin B homolog; SLC9A1 binding protein; calcium-binding protein CHP; calcineurin homologous protein; SLC9A1BP; FLJ20350;
Gene ID 11261
mRNA Refseq NM_007236
Protein Refseq NP_009167
MIM 606988

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHP Products

Required fields are marked with *

My Review for All CHP Products

Required fields are marked with *

0
cart-icon
0
compare icon