Recombinant Human CHP2 Protein, GST-Tagged
Cat.No. : | CHP2-1262H |
Product Overview : | Human CHP2 full-length ORF (BAG35891.1, 1 a.a. - 196 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene product is a small calcium-binding protein that regulates cell pH by controlling plasma membrane-type Na+/H+ exchange activity. This protein shares sequence similarity with calcineurin B and can bind to and stimulate the protein phosphatase activity of calcineurin A (CnA) and functions in the calcineurin/NFAT (nuclear factor of activated T cells) signaling pathway. Another member of the CHP subfamily, Calcineurin B homologous protein 1, is located on Chromosome 15 and is an inhibitor of calcineurin activity and has a genetic phenotype associated with Parkinson's Disease (OMIM:606988). This gene was initially identified as a tumor-associated antigen and was previously referred to as Hepatocellular carcinoma-associated antigen 520. [provided by RefSeq, Jul 2013] |
Molecular Mass : | 47.96 kDa |
AA Sequence : | MGSRSSHAAVIPDGDSIRRETGFSQASLLRLHHRFRALDRNKKGYLSRMDLQQIGALAVNPLGDRIIESFFPDGSQRVDFPGFVRVLAHFRPVEDEDTETQDPKKPEPLNSRRNKLHYAFQLYDLDRDGKISRHEMLQVLRLMVGVQVTEEQLENIADRTVQEADEDGDGAVSFVEFTKSLEKMDVEQKMSIRILK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHP2 calcineurin B homologous protein 2 [ Homo sapiens ] |
Official Symbol | CHP2 |
Synonyms | CHP2; calcineurin B homologous protein 2; hepatocellular carcinoma antigen gene 520; hepatocellular carcinoma-associated antigen 520; |
Gene ID | 63928 |
mRNA Refseq | NM_022097 |
Protein Refseq | NP_071380 |
◆ Recombinant Proteins | ||
CHP2-1040R | Recombinant Rat CHP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHP2-3215HF | Recombinant Full Length Human CHP2 Protein, GST-tagged | +Inquiry |
CHP2-1262H | Recombinant Human CHP2 Protein, GST-Tagged | +Inquiry |
CHP2-10211Z | Recombinant Zebrafish CHP2 | +Inquiry |
CHP2-1382R | Recombinant Rat CHP2 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHP2 Products
Required fields are marked with *
My Review for All CHP2 Products
Required fields are marked with *