Recombinant Human CHPT1 Protein, GST-Tagged
Cat.No. : | CHPT1-1264H |
Product Overview : | Human CHPT1 full-length ORF (NP_064629.2, 1 a.a. - 406 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CHPT1 (Choline Phosphotransferase 1) is a Protein Coding gene. Among its related pathways are phosphatidylcholine biosynthesis and Synthesis of PC. GO annotations related to this gene include diacylglycerol binding and diacylglycerol cholinephosphotransferase activity. An important paralog of this gene is CEPT1. |
Molecular Mass : | 71.5 kDa |
AA Sequence : | MAAGAGAGSAPRWLRALSEPLSAAQLRRLEEHRYSAAGVSLLEPPLQLYWTWLLQWIPLWMAPNSITLLGLAVNVVTTLVLISYCPTATEEAPYWTYLLCALGLFIYQSLDAIDGKQARRTNSCSPLGELFDHGCDSLSTVFMAVGASIAARLGTYPDWFFFCSFIGMFVFYCAHWQTYVSGMLRFGKVDVTEIQIALVIVFVLSAFGGATMWDYTIPILEIKLKILPVLGFLGGVIFSCSNYFHVILHGGVGKNGSTIAGTSVLSPGLHIGLIIILAIMIYKKSATDVFEKHPCLYILMFGCVFAKVSQKLVVAHMTKSELYLQDTVFLGPGLLFLDQYFNNFIDEYVVLWMAMVISSFDMVIYFSALCLQISRHLHLNIFKTACHQAPEQVQVLSSKSHQNNMD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHPT1 choline phosphotransferase 1 [ Homo sapiens ] |
Official Symbol | CHPT1 |
Synonyms | CHPT1; choline phosphotransferase 1; cholinephosphotransferase 1; CPT1; phosphatidylcholine synthesizing enzyme; hCPT1; AAPT1-like protein; cholinephosphotransferase 1 alpha; diacylglycerol cholinephosphotransferase 1; CPT; |
Gene ID | 56994 |
mRNA Refseq | NM_020244 |
Protein Refseq | NP_064629 |
MIM | 616747 |
UniProt ID | Q8WUD6 |
◆ Recombinant Proteins | ||
CHPT1-11902Z | Recombinant Zebrafish CHPT1 | +Inquiry |
CHPT1-3217HF | Recombinant Full Length Human CHPT1 Protein, GST-tagged | +Inquiry |
CHPT1-1041R | Recombinant Rat CHPT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL2500GF | Recombinant Full Length Chicken Cholinephosphotransferase 1(Chpt1) Protein, His-Tagged | +Inquiry |
CHPT1-1383R | Recombinant Rat CHPT1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHPT1 Products
Required fields are marked with *
My Review for All CHPT1 Products
Required fields are marked with *