Recombinant Human CHRAC1 Protein, GST-Tagged
Cat.No. : | CHRAC1-1265H |
Product Overview : | Human CHRAC1 full-length ORF (AAH15891, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CHPT1 (Choline Phosphotransferase 1) is a Protein Coding gene. Among its related pathways are phosphatidylcholine biosynthesis and Synthesis of PC. GO annotations related to this gene include diacylglycerol binding and diacylglycerol cholinephosphotransferase activity. An important paralog of this gene is CEPT1. |
Molecular Mass : | 40.15 kDa |
AA Sequence : | MADVVVGKDKGGEQRLISLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCLATYSYRHGSGKEKKVLTYSDLANTAQQSETFQFLADILPKKILASKYLKMLKEEKREEDEENDNDNESDHDEADS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHRAC1 chromatin accessibility complex 1 [ Homo sapiens ] |
Official Symbol | CHRAC1 |
Synonyms | CHRAC1; chromatin accessibility complex 1; chromatin accessibility complex protein 1; CHRAC15; histone fold protein CHRAC15; YCL1; histone-fold protein CHRAC15; DNA polymerase epsilon subunit p15; chromatin accessibility complex 15 kDa protein; CHARC1; CHARC15; CHRAC-1; CHRAC-15; |
Gene ID | 54108 |
mRNA Refseq | NM_017444 |
Protein Refseq | NP_059140 |
MIM | 607268 |
UniProt ID | Q9NRG0 |
◆ Recombinant Proteins | ||
CHRAC1-301597H | Recombinant Human CHRAC1 protein, GST-tagged | +Inquiry |
CHRAC1-1265H | Recombinant Human CHRAC1 Protein, GST-Tagged | +Inquiry |
CHRAC1-3420M | Recombinant Mouse CHRAC1 Protein | +Inquiry |
CHRAC1-7555H | Recombinant Human CHRAC1 protein, His-tagged | +Inquiry |
CHRAC1-3218HF | Recombinant Full Length Human CHRAC1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHRAC1-7525HCL | Recombinant Human CHRAC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHRAC1 Products
Required fields are marked with *
My Review for All CHRAC1 Products
Required fields are marked with *
0
Inquiry Basket