Recombinant Human CHRAC1 Protein, GST-Tagged

Cat.No. : CHRAC1-1265H
Product Overview : Human CHRAC1 full-length ORF (AAH15891, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CHPT1 (Choline Phosphotransferase 1) is a Protein Coding gene. Among its related pathways are phosphatidylcholine biosynthesis and Synthesis of PC. GO annotations related to this gene include diacylglycerol binding and diacylglycerol cholinephosphotransferase activity. An important paralog of this gene is CEPT1.
Molecular Mass : 40.15 kDa
AA Sequence : MADVVVGKDKGGEQRLISLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCLATYSYRHGSGKEKKVLTYSDLANTAQQSETFQFLADILPKKILASKYLKMLKEEKREEDEENDNDNESDHDEADS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CHRAC1 chromatin accessibility complex 1 [ Homo sapiens ]
Official Symbol CHRAC1
Synonyms CHRAC1; chromatin accessibility complex 1; chromatin accessibility complex protein 1; CHRAC15; histone fold protein CHRAC15; YCL1; histone-fold protein CHRAC15; DNA polymerase epsilon subunit p15; chromatin accessibility complex 15 kDa protein; CHARC1; CHARC15; CHRAC-1; CHRAC-15;
Gene ID 54108
mRNA Refseq NM_017444
Protein Refseq NP_059140
MIM 607268
UniProt ID Q9NRG0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHRAC1 Products

Required fields are marked with *

My Review for All CHRAC1 Products

Required fields are marked with *

0
cart-icon