Recombinant Human CHRM2 Protein, GST-Tagged
Cat.No. : | CHRM2-1271H |
Product Overview : | Human CHRM2 partial ORF (AAI06743.1, 251 a.a. - 350 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine to these receptors and includes cellular responses such as adenylate cyclase inhibition, phosphoinositide degeneration, and potassium channel mediation. Muscarinic receptors influence many effects of acetylcholine in the central and peripheral nervous system. The muscarinic cholinergic receptor 2 is involved in mediation of bradycardia and a decrease in cardiac contractility. Multiple alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | SDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDEITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHRM2 cholinergic receptor, muscarinic 2 [ Homo sapiens ] |
Official Symbol | CHRM2 |
Synonyms | CHRM2; cholinergic receptor, muscarinic 2; muscarinic acetylcholine receptor M2; acetylcholine receptor; muscarinic 2; 7TM receptor; muscarinic M2 receptor; acetylcholine receptor, muscarinic 2; cholinergic receptor, muscarinic 2, isoform a; HM2; FLJ43243; MGC120006; MGC120007; |
Gene ID | 1129 |
mRNA Refseq | NM_000739 |
Protein Refseq | NP_000730 |
MIM | 118493 |
UniProt ID | P08172 |
◆ Recombinant Proteins | ||
CHRM2-175H | Recombinant Human CHRM2 | +Inquiry |
RFL35358HF | Recombinant Full Length Human Muscarinic Acetylcholine Receptor M2(Chrm2) Protein, His-Tagged | +Inquiry |
CHRM2-1044R | Recombinant Rat CHRM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHRM2-1386R | Recombinant Rat CHRM2 Protein | +Inquiry |
CHRM2-1659M | Recombinant Mouse CHRM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHRM2-7520HCL | Recombinant Human CHRM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHRM2 Products
Required fields are marked with *
My Review for All CHRM2 Products
Required fields are marked with *
0
Inquiry Basket