Recombinant Human CHRM3 Protein (253-492 aa), His-B2M-tagged

Cat.No. : CHRM3-2276H
Product Overview : Recombinant Human CHRM3 Protein (253-492 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-B2M tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : B2M&His
Protein Length : 253-492 aa
Description : The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 40.7 kDa
AA Sequence : RIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSMKRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKEKKAAQT
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name CHRM3 cholinergic receptor, muscarinic 3 [ Homo sapiens ]
Official Symbol CHRM3
Synonyms CHRM3; acetylcholine receptor; muscarinic 3; m3 muscarinic receptor; HM3; EGBRS;
Gene ID 1131
mRNA Refseq NM_000740
Protein Refseq NP_000731
MIM 118494
UniProt ID P20309

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHRM3 Products

Required fields are marked with *

My Review for All CHRM3 Products

Required fields are marked with *

0
cart-icon