Recombinant Human CHRM3 Protein (253-492 aa), His-B2M-tagged
Cat.No. : | CHRM3-2276H |
Product Overview : | Recombinant Human CHRM3 Protein (253-492 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-B2M tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | B2M&His |
Protein Length : | 253-492 aa |
Description : | The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 40.7 kDa |
AA Sequence : | RIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSMKRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKEKKAAQT |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | CHRM3 cholinergic receptor, muscarinic 3 [ Homo sapiens ] |
Official Symbol | CHRM3 |
Synonyms | CHRM3; acetylcholine receptor; muscarinic 3; m3 muscarinic receptor; HM3; EGBRS; |
Gene ID | 1131 |
mRNA Refseq | NM_000740 |
Protein Refseq | NP_000731 |
MIM | 118494 |
UniProt ID | P20309 |
◆ Recombinant Proteins | ||
CHRM3-6950C | Recombinant Chicken CHRM3 | +Inquiry |
RFL4506GF | Recombinant Full Length Chicken Muscarinic Acetylcholine Receptor M3(Chrm3) Protein, His-Tagged | +Inquiry |
CHRM3-7443H | Recombinant Human CHRM3 protein, His-tagged | +Inquiry |
RFL9346BF | Recombinant Full Length Bovine Muscarinic Acetylcholine Receptor M3(Chrm3) Protein, His-Tagged | +Inquiry |
CHRM3-3222HF | Recombinant Full Length Human CHRM3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHRM3-7519HCL | Recombinant Human CHRM3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHRM3 Products
Required fields are marked with *
My Review for All CHRM3 Products
Required fields are marked with *
0
Inquiry Basket