Recombinant Human CHRM5 Protein, GST-Tagged
Cat.No. : | CHRM5-1276H |
Product Overview : | Human CHRM5 partial ORF (NP_036257, 281 a.a. - 390 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine and includes cellular responses such as adenylate cyclase inhibition, phosphoinositide degeneration, and potassium channel mediation. Muscarinic receptors influence many effects of acetylcholine in the central and peripheral nervous system. The clinical implications of this receptor are unknown; however, stimulation of this receptor is known to increase cyclic AMP levels. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 37.84 kDa |
AA Sequence : | TGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPNYLLSPAAAHRPKSQKCVAYKFRLVVKADGN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHRM5 cholinergic receptor, muscarinic 5 [ Homo sapiens ] |
Official Symbol | CHRM5 |
Synonyms | CHRM5; cholinergic receptor, muscarinic 5; muscarinic acetylcholine receptor M5; acetylcholine receptor; muscarinic 5; acetylcholine receptor, muscarinic 5; HM5; MGC41838; |
Gene ID | 1133 |
mRNA Refseq | NM_012125 |
Protein Refseq | NP_036257 |
MIM | 118496 |
UniProt ID | P08912 |
◆ Recombinant Proteins | ||
RFL137RF | Recombinant Full Length Rat Muscarinic Acetylcholine Receptor M5(Chrm5) Protein, His-Tagged | +Inquiry |
CHRM5-1046R | Recombinant Rat CHRM5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHRM5-688R | Recombinant Rhesus Macaque CHRM5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHRM5-862R | Recombinant Rhesus monkey CHRM5 Protein, His-tagged | +Inquiry |
CHRM5-3428M | Recombinant Mouse CHRM5 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHRM5-7518HCL | Recombinant Human CHRM5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHRM5 Products
Required fields are marked with *
My Review for All CHRM5 Products
Required fields are marked with *