Recombinant Human CHRM5 Protein, GST-Tagged

• Cat.No.: CHRM5-1276H
• Product Overview: Human CHRM5 partial ORF (NP_036257, 281 a.a. - 390 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine and includes cellular responses such as adenylate cyclase inhibition, phosphoinositide degeneration, and potassium channel mediation. Muscarinic receptors influence many effects of acetylcholine in the central and peripheral nervous system. The clinical implications of this receptor are unknown; however, stimulation of this receptor is known to increase cyclic AMP levels. [provided by RefSeq, Jul 2008]
• Molecular Mass: 37.84 kDa
• AA Sequence: TGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPNYLLSPAAAHRPKSQKCVAYKFRLVVKADGN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CHRM5 cholinergic receptor, muscarinic 5 [ Homo sapiens ]
• Official Symbol: CHRM5
• Synonyms: CHRM5; cholinergic receptor, muscarinic 5; muscarinic acetylcholine receptor M5; acetylcholine receptor; muscarinic 5; acetylcholine receptor, muscarinic 5; HM5; MGC41838
• Gene ID: 1133
• mRNA Refseq: NM_012125
• Protein Refseq: NP_036257
• MIM: 118496
• UniProt ID: P08912