Recombinant Human CHRM5 protein, His-tagged
| Cat.No. : | CHRM5-4533H |
| Product Overview : | Recombinant Human CHRM5 protein(P08912)(215-443aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 215-443aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 31.5 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | RIYRETEKRTKDLADLQGSDSVTKAEKRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPNYLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRKRVVLVKERKAAQT |
| Gene Name | CHRM5 cholinergic receptor, muscarinic 5 [ Homo sapiens ] |
| Official Symbol | CHRM5 |
| Synonyms | CHRM5; cholinergic receptor, muscarinic 5; muscarinic acetylcholine receptor M5; acetylcholine receptor; muscarinic 5; acetylcholine receptor, muscarinic 5; HM5; MGC41838; |
| Gene ID | 1133 |
| mRNA Refseq | NM_012125 |
| Protein Refseq | NP_036257 |
| MIM | 118496 |
| UniProt ID | P08912 |
| ◆ Recombinant Proteins | ||
| CHRM5-1097HFL | Recombinant Human CHRM5 protein, His&Flag-tagged | +Inquiry |
| CHRM5-1275H | Recombinant Human CHRM5 Protein | +Inquiry |
| RFL137RF | Recombinant Full Length Rat Muscarinic Acetylcholine Receptor M5(Chrm5) Protein, His-Tagged | +Inquiry |
| CHRM5-3428M | Recombinant Mouse CHRM5 Protein | +Inquiry |
| CHRM5-862R | Recombinant Rhesus monkey CHRM5 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CHRM5-7518HCL | Recombinant Human CHRM5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHRM5 Products
Required fields are marked with *
My Review for All CHRM5 Products
Required fields are marked with *
