Recombinant Human CHRNA1 protein, His-tagged
Cat.No. : | CHRNA1-125H |
Product Overview : | Recombinant human CHRNA1 protein extracellular domain (21-209aa) fused with His Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 21-209 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTN VRQNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYC EIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVT |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | CHRNA1 cholinergic receptor, nicotinic, alpha 1 (muscle) [ Homo sapiens ] |
Official Symbol | CHRNA1 |
Synonyms | CHRNA1; cholinergic receptor, nicotinic, alpha 1 (muscle); cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle) , CHRNA; acetylcholine receptor subunit alpha; acetylcholine receptor; nicotinic; alpha 1 (muscle); nicotinic cholinergic receptor alpha 1; muscle nicotinic acetylcholine receptor; nicotinic acetylcholine receptor alpha subunit; acetylcholine receptor, nicotinic, alpha 1 (muscle); cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle); ACHRA; ACHRD; CHRNA; CMS2A; FCCMS; SCCMS; |
Gene ID | 1134 |
mRNA Refseq | NM_000079 |
Protein Refseq | NP_000070 |
MIM | 100690 |
UniProt ID | P02708 |
Chromosome Location | 2q31.1 |
Pathway | Acetylcholine Binding And Downstream Events, organism-specific biosystem; Activation of Nicotinic Acetylcholine Receptors, organism-specific biosystem; Effects of Botulinum toxin, organism-specific biosystem; ErbB2/ErbB3 signaling events, organism-specific biosystem; Highly calcium permeable nicotinic acetylcholine receptors, organism-specific biosystem; Highly calcium permeable postsynaptic nicotinic acetylcholine receptors, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem; |
Function | contributes_to acetylcholine binding; contributes_to acetylcholine receptor activity; acetylcholine-activated cation-selective channel activity; contributes_to acetylcholine-activated cation-selective channel activity; extracellular ligand-gated ion chann |
◆ Recombinant Proteins | ||
CHRNA1-2694H | Recombinant Human CHRNA1 protein, His-tagged | +Inquiry |
CHRNA1-1662M | Recombinant Mouse CHRNA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHRNA1-1515T | Recombinant Torpedo californica CHRNA1 protein, His-tagged | +Inquiry |
Chrna1-3053M | Recombinant Mouse Chrna1, His-tagged | +Inquiry |
CHRNA1-30388TH | Recombinant Human CHRNA1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHRNA1-7517HCL | Recombinant Human CHRNA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHRNA1 Products
Required fields are marked with *
My Review for All CHRNA1 Products
Required fields are marked with *