Recombinant Human CHRNA1 protein, His-tagged

Cat.No. : CHRNA1-125H
Product Overview : Recombinant human CHRNA1 protein extracellular domain (21-209aa) fused with His Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 21-209 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTN VRQNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYC EIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVT
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name CHRNA1 cholinergic receptor, nicotinic, alpha 1 (muscle) [ Homo sapiens ]
Official Symbol CHRNA1
Synonyms CHRNA1; cholinergic receptor, nicotinic, alpha 1 (muscle); cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle) , CHRNA; acetylcholine receptor subunit alpha; acetylcholine receptor; nicotinic; alpha 1 (muscle); nicotinic cholinergic receptor alpha 1; muscle nicotinic acetylcholine receptor; nicotinic acetylcholine receptor alpha subunit; acetylcholine receptor, nicotinic, alpha 1 (muscle); cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle); ACHRA; ACHRD; CHRNA; CMS2A; FCCMS; SCCMS;
Gene ID 1134
mRNA Refseq NM_000079
Protein Refseq NP_000070
MIM 100690
UniProt ID P02708
Chromosome Location 2q31.1
Pathway Acetylcholine Binding And Downstream Events, organism-specific biosystem; Activation of Nicotinic Acetylcholine Receptors, organism-specific biosystem; Effects of Botulinum toxin, organism-specific biosystem; ErbB2/ErbB3 signaling events, organism-specific biosystem; Highly calcium permeable nicotinic acetylcholine receptors, organism-specific biosystem; Highly calcium permeable postsynaptic nicotinic acetylcholine receptors, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem;
Function contributes_to acetylcholine binding; contributes_to acetylcholine receptor activity; acetylcholine-activated cation-selective channel activity; contributes_to acetylcholine-activated cation-selective channel activity; extracellular ligand-gated ion chann

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHRNA1 Products

Required fields are marked with *

My Review for All CHRNA1 Products

Required fields are marked with *

0
cart-icon
0
compare icon