Recombinant Pacific electric ray CHRNA1 protein

Cat.No. : CHRNA1-408T
Product Overview : Recombinant Pacific electric ray CHRNA1 protein(P02710)(25-234aa) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Pacific electric ray
Source : E.coli
Tag : His
Protein Length : 25-234a
Form : Tris-based buffer,50% glycerol
Molecular Mass : 28.8 kDa
AA Sequence : SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLISVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRI
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHRNA1 Products

Required fields are marked with *

My Review for All CHRNA1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon