Recombinant Pacific electric ray CHRNA1 protein

• Cat.No.: CHRNA1-408T
• Product Overview: Recombinant Pacific electric ray CHRNA1 protein(P02710)(25-234aa) was expressed in E. coli.

Specification

• Species: Pacific electric ray
• Source: E.coli
• Tag: His
• Protein Length: 25-234a
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 28.8 kDa
• AA Sequence: SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLISVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRI
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.