Recombinant Pacific electric ray CHRNA1 protein
Cat.No. : | CHRNA1-408T |
Product Overview : | Recombinant Pacific electric ray CHRNA1 protein(P02710)(25-234aa) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pacific electric ray |
Source : | E.coli |
Tag : | His |
Protein Length : | 25-234a |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 28.8 kDa |
AA Sequence : | SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLISVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRI |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
◆ Recombinant Proteins | ||
CHRNA1-3429M | Recombinant Mouse CHRNA1 Protein | +Inquiry |
Chrna1-778R | Recombinant Rat Chrna1 Protein, His-tagged | +Inquiry |
CHRNA1-125H | Recombinant Human CHRNA1 protein, His-tagged | +Inquiry |
CHRNA1-30388TH | Recombinant Human CHRNA1 | +Inquiry |
CHRNA1-1277H | Recombinant Human CHRNA1 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHRNA1-7517HCL | Recombinant Human CHRNA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHRNA1 Products
Required fields are marked with *
My Review for All CHRNA1 Products
Required fields are marked with *