Recombinant Pacific electric ray CHRNA1 protein
| Cat.No. : | CHRNA1-408T |
| Product Overview : | Recombinant Pacific electric ray CHRNA1 protein(P02710)(25-234aa) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Pacific electric ray |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 25-234a |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 28.8 kDa |
| AA Sequence : | SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLISVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRI |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHRNA1 Products
Required fields are marked with *
My Review for All CHRNA1 Products
Required fields are marked with *
