Recombinant Human CHRNA7 protein, His-tagged

• Cat.No.: CHRNA7-6875H
• Product Overview: Recombinant Human CHRNA7 protein(130-321 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 130-321 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
• AASequence: TVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHKQRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPNFVEAVSKDFA
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: CHRNA7 cholinergic receptor, nicotinic, alpha 7 (neuronal) [ Homo sapiens ]
• Official Symbol: CHRNA7
• Synonyms: CHRNA7; cholinergic receptor, nicotinic, alpha 7 (neuronal); cholinergic receptor, nicotinic, alpha polypeptide 7; neuronal acetylcholine receptor subunit alpha-7; acetylcholine receptor; nicotinic; alpha 7 (neuronal); a7 nicotinic acetylcholine receptor; alpha-7 nicotinic cholinergic receptor subunit; alpha 7 neuronal nicotinic acetylcholine receptor; acetylcholine receptor, nicotinic, alpha 7 (neuronal); neuronal acetylcholine receptor protein, alpha-7 chain; NACHRA7; CHRNA7-2
• Gene ID: 1139
• mRNA Refseq: NM_000746
• Protein Refseq: NP_000737
• MIM: 118511
• UniProt ID: P36544