Recombinant Human CHRNA7 protein, His-tagged
Cat.No. : | CHRNA7-6875H |
Product Overview : | Recombinant Human CHRNA7 protein(130-321 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 130-321 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | TVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHKQRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPNFVEAVSKDFA |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | CHRNA7 cholinergic receptor, nicotinic, alpha 7 (neuronal) [ Homo sapiens ] |
Official Symbol | CHRNA7 |
Synonyms | CHRNA7; cholinergic receptor, nicotinic, alpha 7 (neuronal); cholinergic receptor, nicotinic, alpha polypeptide 7; neuronal acetylcholine receptor subunit alpha-7; acetylcholine receptor; nicotinic; alpha 7 (neuronal); a7 nicotinic acetylcholine receptor; alpha-7 nicotinic cholinergic receptor subunit; alpha 7 neuronal nicotinic acetylcholine receptor; acetylcholine receptor, nicotinic, alpha 7 (neuronal); neuronal acetylcholine receptor protein, alpha-7 chain; NACHRA7; CHRNA7-2; |
Gene ID | 1139 |
mRNA Refseq | NM_000746 |
Protein Refseq | NP_000737 |
MIM | 118511 |
UniProt ID | P36544 |
◆ Recombinant Proteins | ||
CHRNA7-1052R | Recombinant Rat CHRNA7 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHRNA7-83HF | Recombinant Full Length Human CHRNA7 Protein | +Inquiry |
CHRNA7-11431Z | Recombinant Zebrafish CHRNA7 | +Inquiry |
CHRNA7-177H | Recombinant Human CHRNA7 | +Inquiry |
CHRNA7-30390TH | Recombinant Human CHRNA7 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHRNA7-7514HCL | Recombinant Human CHRNA7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHRNA7 Products
Required fields are marked with *
My Review for All CHRNA7 Products
Required fields are marked with *