Recombinant Human CHRNB2 protein, His-V5-tagged
| Cat.No. : | CHRNB2-0003H |
| Product Overview : | Recombinant Human CHRNB2 protein(26-233aa)(P17787), fused to N-terminal His tag and V5 tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&V5 |
| Protein Length : | 26-233aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 31.9 kDa |
| AA Sequence : | TDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWDIVALPGRRNENPDDSTYVDITYDFIIRRK |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | CHRNB2 cholinergic receptor, nicotinic, beta 2 (neuronal) [ Homo sapiens ] |
| Official Symbol | CHRNB2 |
| Synonyms | CHRNB2; cholinergic receptor, nicotinic, beta 2 (neuronal); cholinergic receptor, nicotinic, beta polypeptide 2 (neuronal); neuronal acetylcholine receptor subunit beta-2; acetylcholine receptor; nicotinic; beta 2 (neuronal); neuronal nicotinic acetylcholine receptor beta 2; acetylcholine receptor, nicotinic, beta 2 (neuronal); EFNL3; nAChRB2; |
| Gene ID | 1141 |
| mRNA Refseq | NM_000748 |
| Protein Refseq | NP_000739 |
| MIM | 118507 |
| UniProt ID | P17787 |
| ◆ Recombinant Proteins | ||
| RFL9989GF | Recombinant Full Length Chicken Neuronal Acetylcholine Receptor Subunit Beta-2(Chrnb2) Protein, His-Tagged | +Inquiry |
| CHRNB2-3242HF | Recombinant Full Length Human CHRNB2 Protein, GST-tagged | +Inquiry |
| CHRNB2-1397R | Recombinant Rat CHRNB2 Protein | +Inquiry |
| CHRNB2-6376C | Recombinant Chicken CHRNB2 | +Inquiry |
| CHRNB2-1286H | Recombinant Human CHRNB2 Protein, GST-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CHRNB2-7512HCL | Recombinant Human CHRNB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHRNB2 Products
Required fields are marked with *
My Review for All CHRNB2 Products
Required fields are marked with *




