Recombinant Human CHRNB2 protein, His-V5-tagged
Cat.No. : | CHRNB2-0003H |
Product Overview : | Recombinant Human CHRNB2 protein(26-233aa)(P17787), fused to N-terminal His tag and V5 tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&V5 |
Protein Length : | 26-233aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 31.9 kDa |
AA Sequence : | TDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWDIVALPGRRNENPDDSTYVDITYDFIIRRK |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | CHRNB2 cholinergic receptor, nicotinic, beta 2 (neuronal) [ Homo sapiens ] |
Official Symbol | CHRNB2 |
Synonyms | CHRNB2; cholinergic receptor, nicotinic, beta 2 (neuronal); cholinergic receptor, nicotinic, beta polypeptide 2 (neuronal); neuronal acetylcholine receptor subunit beta-2; acetylcholine receptor; nicotinic; beta 2 (neuronal); neuronal nicotinic acetylcholine receptor beta 2; acetylcholine receptor, nicotinic, beta 2 (neuronal); EFNL3; nAChRB2; |
Gene ID | 1141 |
mRNA Refseq | NM_000748 |
Protein Refseq | NP_000739 |
MIM | 118507 |
UniProt ID | P17787 |
◆ Recombinant Proteins | ||
CHRNB2-1055R | Recombinant Rat CHRNB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL9989GF | Recombinant Full Length Chicken Neuronal Acetylcholine Receptor Subunit Beta-2(Chrnb2) Protein, His-Tagged | +Inquiry |
CHRNB2-864R | Recombinant Rhesus monkey CHRNB2 Protein, His-tagged | +Inquiry |
CHRNB2-11217H | Recombinant Human CHRNB2, His-tagged | +Inquiry |
CHRNB2-1397R | Recombinant Rat CHRNB2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHRNB2-7512HCL | Recombinant Human CHRNB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHRNB2 Products
Required fields are marked with *
My Review for All CHRNB2 Products
Required fields are marked with *