Recombinant Human CHRNB2 protein, His-V5-tagged

Cat.No. : CHRNB2-0003H
Product Overview : Recombinant Human CHRNB2 protein(26-233aa)(P17787), fused to N-terminal His tag and V5 tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&V5
Protein Length : 26-233aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 31.9 kDa
AA Sequence : TDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWDIVALPGRRNENPDDSTYVDITYDFIIRRK
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name CHRNB2 cholinergic receptor, nicotinic, beta 2 (neuronal) [ Homo sapiens ]
Official Symbol CHRNB2
Synonyms CHRNB2; cholinergic receptor, nicotinic, beta 2 (neuronal); cholinergic receptor, nicotinic, beta polypeptide 2 (neuronal); neuronal acetylcholine receptor subunit beta-2; acetylcholine receptor; nicotinic; beta 2 (neuronal); neuronal nicotinic acetylcholine receptor beta 2; acetylcholine receptor, nicotinic, beta 2 (neuronal); EFNL3; nAChRB2;
Gene ID 1141
mRNA Refseq NM_000748
Protein Refseq NP_000739
MIM 118507
UniProt ID P17787

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHRNB2 Products

Required fields are marked with *

My Review for All CHRNB2 Products

Required fields are marked with *

0
cart-icon
0
compare icon