Recombinant Human CHRNB4 protein, His-tagged

• Cat.No.: CHRNB4-5743H
• Product Overview: Recombinant Human CHRNB4 protein(332-451 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 332-451 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: WVKRCFLHKLPTFLFMKRPGPDSSPARAFPPSKSCVTKPEATATSTSPSNFYGNSMYFVNPASAASKSPAGSTPVAIPRDFWLRSSGRFRQDVQEALEGVSFIAQHMKNDDEDQSVVEDW
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: CHRNB4 cholinergic receptor, nicotinic, beta 4 (neuronal) [ Homo sapiens ]
• Official Symbol: CHRNB4
• Synonyms: CHRNB4; cholinergic receptor, nicotinic, beta 4 (neuronal); cholinergic receptor, nicotinic, beta polypeptide 4; neuronal acetylcholine receptor subunit beta-4; acetylcholine receptor; nicotinic; beta 4 (neuronal); neuronal nicotinic receptor beta 4 subunit; acetylcholine receptor, nicotinic, beta 4 (neuronal)
• Gene ID: 1143
• mRNA Refseq: NM_000750
• Protein Refseq: NP_000741
• MIM: 118509
• UniProt ID: P30926