Recombinant Human CHRNB4 protein, His-tagged
Cat.No. : | CHRNB4-5743H |
Product Overview : | Recombinant Human CHRNB4 protein(332-451 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 332-451 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | WVKRCFLHKLPTFLFMKRPGPDSSPARAFPPSKSCVTKPEATATSTSPSNFYGNSMYFVNPASAASKSPAGSTPVAIPRDFWLRSSGRFRQDVQEALEGVSFIAQHMKNDDEDQSVVEDW |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | CHRNB4 cholinergic receptor, nicotinic, beta 4 (neuronal) [ Homo sapiens ] |
Official Symbol | CHRNB4 |
Synonyms | CHRNB4; cholinergic receptor, nicotinic, beta 4 (neuronal); cholinergic receptor, nicotinic, beta polypeptide 4; neuronal acetylcholine receptor subunit beta-4; acetylcholine receptor; nicotinic; beta 4 (neuronal); neuronal nicotinic receptor beta 4 subunit; acetylcholine receptor, nicotinic, beta 4 (neuronal); |
Gene ID | 1143 |
mRNA Refseq | NM_000750 |
Protein Refseq | NP_000741 |
MIM | 118509 |
UniProt ID | P30926 |
◆ Cell & Tissue Lysates | ||
CHRNB4-7511HCL | Recombinant Human CHRNB4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHRNB4 Products
Required fields are marked with *
My Review for All CHRNB4 Products
Required fields are marked with *