Recombinant Human CHRND Protein, GST-Tagged
Cat.No. : | CHRND-1291H |
Product Overview : | Human CHRND partial ORF (NP_000742, 24 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The acetylcholine receptor of muscle has 5 subunits of 4 different types: 2 alpha and 1 each of beta, gamma and delta subunits. After acetylcholine binding, the receptor undergoes an extensive conformation change that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. Defects in this gene are a cause of multiple pterygium syndrome lethal type (MUPSL), congenital myasthenic syndrome slow-channel type (SCCMS), and congenital myasthenic syndrome fast-channel type (FCCMS). Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2015] |
Molecular Mass : | 37.51 kDa |
AA Sequence : | EEERLIRHLFQEKGYNKELRPVAHKEESVDVALALTLSNLISLKEVEETLTTNVWIEHGWTDNRLKWNAEEFGNISVLRLPPDMVWLPEIVLENNNDGSFQISYSCN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHRND cholinergic receptor, nicotinic, delta (muscle) [ Homo sapiens ] |
Official Symbol | CHRND |
Synonyms | CHRND; cholinergic receptor, nicotinic, delta (muscle); ACHRD, cholinergic receptor, nicotinic, delta; acetylcholine receptor subunit delta; acetylcholine receptor; nicotinic; delta (muscle); acetylcholine receptor, nicotinic, delta (muscle); cholinergic receptor, nicotinic, delta polypeptide; ACHRD; CMS2A; FCCMS; SCCMS; |
Gene ID | 1144 |
mRNA Refseq | NM_000751 |
Protein Refseq | NP_000742 |
MIM | 100720 |
UniProt ID | Q07001 |
◆ Recombinant Proteins | ||
Chrnd-3056R | Recombinant Rat Chrnd, His-tagged | +Inquiry |
CHRND-1058R | Recombinant Rat CHRND Protein, His (Fc)-Avi-tagged | +Inquiry |
CHRND-11796Z | Recombinant Zebrafish CHRND | +Inquiry |
CHRND-2971C | Recombinant Chicken CHRND | +Inquiry |
CHRND-1400R | Recombinant Rat CHRND Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHRND-7510HCL | Recombinant Human CHRND 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHRND Products
Required fields are marked with *
My Review for All CHRND Products
Required fields are marked with *