Recombinant Human CHRND Protein, GST-Tagged

• Cat.No.: CHRND-1291H
• Product Overview: Human CHRND partial ORF (NP_000742, 24 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The acetylcholine receptor of muscle has 5 subunits of 4 different types: 2 alpha and 1 each of beta, gamma and delta subunits. After acetylcholine binding, the receptor undergoes an extensive conformation change that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. Defects in this gene are a cause of multiple pterygium syndrome lethal type (MUPSL), congenital myasthenic syndrome slow-channel type (SCCMS), and congenital myasthenic syndrome fast-channel type (FCCMS). Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2015]
• Molecular Mass: 37.51 kDa
• AA Sequence: EEERLIRHLFQEKGYNKELRPVAHKEESVDVALALTLSNLISLKEVEETLTTNVWIEHGWTDNRLKWNAEEFGNISVLRLPPDMVWLPEIVLENNNDGSFQISYSCN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CHRND cholinergic receptor, nicotinic, delta (muscle) [ Homo sapiens ]
• Official Symbol: CHRND
• Synonyms: CHRND; cholinergic receptor, nicotinic, delta (muscle); ACHRD, cholinergic receptor, nicotinic, delta; acetylcholine receptor subunit delta; acetylcholine receptor; nicotinic; delta (muscle); acetylcholine receptor, nicotinic, delta (muscle); cholinergic receptor, nicotinic, delta polypeptide; ACHRD; CMS2A; FCCMS; SCCMS
• Gene ID: 1144
• mRNA Refseq: NM_000751
• Protein Refseq: NP_000742
• MIM: 100720
• UniProt ID: Q07001