Recombinant Human CHRND Protein, GST-Tagged

Cat.No. : CHRND-1291H
Product Overview : Human CHRND partial ORF (NP_000742, 24 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The acetylcholine receptor of muscle has 5 subunits of 4 different types: 2 alpha and 1 each of beta, gamma and delta subunits. After acetylcholine binding, the receptor undergoes an extensive conformation change that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. Defects in this gene are a cause of multiple pterygium syndrome lethal type (MUPSL), congenital myasthenic syndrome slow-channel type (SCCMS), and congenital myasthenic syndrome fast-channel type (FCCMS). Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2015]
Molecular Mass : 37.51 kDa
AA Sequence : EEERLIRHLFQEKGYNKELRPVAHKEESVDVALALTLSNLISLKEVEETLTTNVWIEHGWTDNRLKWNAEEFGNISVLRLPPDMVWLPEIVLENNNDGSFQISYSCN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CHRND cholinergic receptor, nicotinic, delta (muscle) [ Homo sapiens ]
Official Symbol CHRND
Synonyms CHRND; cholinergic receptor, nicotinic, delta (muscle); ACHRD, cholinergic receptor, nicotinic, delta; acetylcholine receptor subunit delta; acetylcholine receptor; nicotinic; delta (muscle); acetylcholine receptor, nicotinic, delta (muscle); cholinergic receptor, nicotinic, delta polypeptide; ACHRD; CMS2A; FCCMS; SCCMS;
Gene ID 1144
mRNA Refseq NM_000751
Protein Refseq NP_000742
MIM 100720
UniProt ID Q07001

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHRND Products

Required fields are marked with *

My Review for All CHRND Products

Required fields are marked with *

0
cart-icon
0
compare icon