Recombinant Human CHRNE Protein, GST-Tagged
Cat.No. : | CHRNE-1293H |
Product Overview : | Human CHRNE partial ORF (NP_000071, 21 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Acetylcholine receptors at mature mammalian neuromuscular junctions are pentameric protein complexes composed of four subunits in the ratio of two alpha subunits to one beta, one epsilon, and one delta subunit. The acetylcholine receptor changes subunit composition shortly after birth when the epsilon subunit replaces the gamma subunit seen in embryonic receptors. Mutations in the epsilon subunit are associated with congenital myasthenic syndrome. [provided by RefSeq, Sep 2009] |
Molecular Mass : | 37.84 kDa |
AA Sequence : | KNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNLISLNEKEETLTTSVWIGIDWQDYRLNYSKDDFGGIETLRVPSELVWLPEIVLENNIDGQFGVAYDANVLV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHRNE cholinergic receptor, nicotinic, epsilon (muscle) [ Homo sapiens ] |
Official Symbol | CHRNE |
Synonyms | CHRNE; cholinergic receptor, nicotinic, epsilon (muscle); cholinergic receptor, nicotinic, epsilon; acetylcholine receptor subunit epsilon; acetylcholine receptor; nicotinic; epsilon (muscle); ACHRE; AchR epsilon subunit; acetylcholine receptor, nicotinic, epsilon (muscle); cholinergic receptor, nicotinic, epsilon polypeptide; CMS1D; CMS1E; CMS2A; FCCMS; SCCMS; |
Gene ID | 1145 |
mRNA Refseq | NM_000080 |
Protein Refseq | NP_000071 |
MIM | 100725 |
UniProt ID | Q04844 |
◆ Recombinant Proteins | ||
CHRNE-1059R | Recombinant Rat CHRNE Protein, His (Fc)-Avi-tagged | +Inquiry |
Chrne-7895M | Recombinant Mouse Chrne protein, His & T7-tagged | +Inquiry |
CHRNE-1106Z | Recombinant Zebrafish CHRNE | +Inquiry |
CHRNE-1293H | Recombinant Human CHRNE Protein, GST-Tagged | +Inquiry |
CHRNE-1401R | Recombinant Rat CHRNE Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHRNE Products
Required fields are marked with *
My Review for All CHRNE Products
Required fields are marked with *
0
Inquiry Basket