Recombinant Human CHRNE Protein, GST-Tagged

Cat.No. : CHRNE-1293H
Product Overview : Human CHRNE partial ORF (NP_000071, 21 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Acetylcholine receptors at mature mammalian neuromuscular junctions are pentameric protein complexes composed of four subunits in the ratio of two alpha subunits to one beta, one epsilon, and one delta subunit. The acetylcholine receptor changes subunit composition shortly after birth when the epsilon subunit replaces the gamma subunit seen in embryonic receptors. Mutations in the epsilon subunit are associated with congenital myasthenic syndrome. [provided by RefSeq, Sep 2009]
Molecular Mass : 37.84 kDa
AA Sequence : KNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNLISLNEKEETLTTSVWIGIDWQDYRLNYSKDDFGGIETLRVPSELVWLPEIVLENNIDGQFGVAYDANVLV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CHRNE cholinergic receptor, nicotinic, epsilon (muscle) [ Homo sapiens ]
Official Symbol CHRNE
Synonyms CHRNE; cholinergic receptor, nicotinic, epsilon (muscle); cholinergic receptor, nicotinic, epsilon; acetylcholine receptor subunit epsilon; acetylcholine receptor; nicotinic; epsilon (muscle); ACHRE; AchR epsilon subunit; acetylcholine receptor, nicotinic, epsilon (muscle); cholinergic receptor, nicotinic, epsilon polypeptide; CMS1D; CMS1E; CMS2A; FCCMS; SCCMS;
Gene ID 1145
mRNA Refseq NM_000080
Protein Refseq NP_000071
MIM 100725
UniProt ID Q04844

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHRNE Products

Required fields are marked with *

My Review for All CHRNE Products

Required fields are marked with *

0
cart-icon
0
compare icon