Recombinant Human CHRNE protein, His&Myc-tagged
| Cat.No. : | CHRNE-5776H |
| Product Overview : | Recombinant Human CHRNE protein(Q04844)(21-239aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 21-239aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 32.5 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | KNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNLISLNEKEETLTTSVWIGIDWQDYRLNYSKDDFGGIETLRVPSELVWLPEIVLENNIDGQFGVAYDANVLVYEGGSVTWLPPAIYRSVCAVEVTYFPFDWQNCSLIFRSQTYNAEEVEFTFAVDNDGKTINKIDIDTEAYTENGEWAIDFCPGVIRRHHGGATDGPGETDVIYSLIIRRK |
| Gene Name | CHRNE cholinergic receptor, nicotinic, epsilon (muscle) [ Homo sapiens ] |
| Official Symbol | CHRNE |
| Synonyms | CHRNE; cholinergic receptor, nicotinic, epsilon (muscle); cholinergic receptor, nicotinic, epsilon; acetylcholine receptor subunit epsilon; acetylcholine receptor; nicotinic; epsilon (muscle); ACHRE; AchR epsilon subunit; acetylcholine receptor, nicotinic, epsilon (muscle); cholinergic receptor, nicotinic, epsilon polypeptide; CMS1D; CMS1E; CMS2A; FCCMS; SCCMS; |
| Gene ID | 1145 |
| mRNA Refseq | NM_000080 |
| Protein Refseq | NP_000071 |
| MIM | 100725 |
| UniProt ID | Q04844 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHRNE Products
Required fields are marked with *
My Review for All CHRNE Products
Required fields are marked with *
