Recombinant Human CHRNE protein, His&Myc-tagged
Cat.No. : | CHRNE-5776H |
Product Overview : | Recombinant Human CHRNE protein(Q04844)(21-239aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 21-239aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 32.5 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | KNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNLISLNEKEETLTTSVWIGIDWQDYRLNYSKDDFGGIETLRVPSELVWLPEIVLENNIDGQFGVAYDANVLVYEGGSVTWLPPAIYRSVCAVEVTYFPFDWQNCSLIFRSQTYNAEEVEFTFAVDNDGKTINKIDIDTEAYTENGEWAIDFCPGVIRRHHGGATDGPGETDVIYSLIIRRK |
Gene Name | CHRNE cholinergic receptor, nicotinic, epsilon (muscle) [ Homo sapiens ] |
Official Symbol | CHRNE |
Synonyms | CHRNE; cholinergic receptor, nicotinic, epsilon (muscle); cholinergic receptor, nicotinic, epsilon; acetylcholine receptor subunit epsilon; acetylcholine receptor; nicotinic; epsilon (muscle); ACHRE; AchR epsilon subunit; acetylcholine receptor, nicotinic, epsilon (muscle); cholinergic receptor, nicotinic, epsilon polypeptide; CMS1D; CMS1E; CMS2A; FCCMS; SCCMS; |
Gene ID | 1145 |
mRNA Refseq | NM_000080 |
Protein Refseq | NP_000071 |
MIM | 100725 |
UniProt ID | Q04844 |
◆ Recombinant Proteins | ||
CHRNE-1671M | Recombinant Mouse CHRNE Protein, His (Fc)-Avi-tagged | +Inquiry |
CHRNE-29131TH | Recombinant Human CHRNE | +Inquiry |
RFL7869XF | Recombinant Full Length Xenopus Laevis Acetylcholine Receptor Subunit Epsilon(Chrne) Protein, His-Tagged | +Inquiry |
CHRNE-5776H | Recombinant Human CHRNE protein, His&Myc-tagged | +Inquiry |
RFL32653MF | Recombinant Full Length Mouse Acetylcholine Receptor Subunit Epsilon(Chrne) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHRNE Products
Required fields are marked with *
My Review for All CHRNE Products
Required fields are marked with *