Recombinant Human CHST10 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | CHST10-309H |
Product Overview : | CHST10 MS Standard C13 and N15-labeled recombinant protein (NP_004845) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This protein encoded by this gene transfers sulfate to the C-3 hydroxyl of terminal glucuronic acid of protein- and lipid-linked oligosaccharides. This protein was first identified as a sulfotransferase that acts on the human natural killer-1 (HNK-1) glycan; HNK-1 is a carbohydrate involved in neurodevelopment and synaptic plasticity. [provided by RefSeq, Feb 2011] |
Molecular Mass : | 42.2 kDa |
AA Sequence : | MHHQWLLLAACFWVIFMFMVASKFITLTFKDPDVYSAKQEFLFLTTMPEVRKLPEEKHIPEELKPTGKELPDSQLVQPLVYMERLELIRNVCRDDALKNLSHTPVSKFVLDRIFVCDKHKILFCQTPKVGNTQWKKVLIVLNGAFSSIEEIPENVVHDHEKNGLPRLSSFSDAEIQKRLKTYFKFFIVRDPFERLISAFKDKFVHNPRFEPWYRHEIAPGIIRKYRRNRTETRGIQFEDFVRYLGDPNHRWLDLQFGDHIIHWVTYVELCAPCEIMYSVIGHHETLEDDAPYILKEAGIDHLVSYPTIPPGITVYNRTKVEHYFLGISKRDIRRLYARFEGDFKLFGYQKPDFLLNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CHST10 carbohydrate sulfotransferase 10 [ Homo sapiens (human) ] |
Official Symbol | CHST10 |
Synonyms | CHST10; carbohydrate sulfotransferase 10; HNK1ST; HNK-1ST; carbohydrate sulfotransferase 10; HNK-1 sulfotransferase; huHNK-1ST; EC 2.8.2.- |
Gene ID | 9486 |
mRNA Refseq | NM_004854 |
Protein Refseq | NP_004845 |
MIM | 606376 |
UniProt ID | O43529 |
◆ Recombinant Proteins | ||
CHST10-309H | Recombinant Human CHST10 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
CHST10-967H | Recombinant Human CHST10 Protein, Myc/DDK-tagged | +Inquiry |
CHST10-866R | Recombinant Rhesus monkey CHST10 Protein, His-tagged | +Inquiry |
CHST10-1062R | Recombinant Rat CHST10 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL21200HF | Recombinant Full Length Human Carbohydrate Sulfotransferase 10(Chst10) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHST10-7508HCL | Recombinant Human CHST10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHST10 Products
Required fields are marked with *
My Review for All CHST10 Products
Required fields are marked with *