Recombinant Human CHST11 Protein, GST-Tagged

Cat.No. : CHST11-1295H
Product Overview : Human CHST11 partial ORF (NP_060883, 230 a.a. - 337 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene belongs to the sulfotransferase 2 family. It is localized to the golgi membrane, and catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of chondroitin. Chondroitin sulfate constitutes the predominant proteoglycan present in cartilage, and is distributed on the surfaces of many cells and extracellular matrices. A chromosomal translocation involving this gene and IgH, t(12;14)(q23;q32), has been reported in a patient with B-cell chronic lymphocytic leukemia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011]
Molecular Mass : 37.62 kDa
AA Sequence : RKGDDVKFEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDSNYVLQLAGVGSYLKFPTYAKSTRTTDEMTTEFFQNISSEHQTQLYEVYKLD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CHST11 carbohydrate (chondroitin 4) sulfotransferase 11 [ Homo sapiens ]
Official Symbol CHST11
Synonyms CHST11; carbohydrate (chondroitin 4) sulfotransferase 11; carbohydrate sulfotransferase 11; C4ST; C4St 1; C4ST1; HSA269537; C4S-1; IgH/CHST11 fusion; chondroitin 4-O-sulfotransferase 1; C4ST-1; FLJ41682; DKFZp667A035;
Gene ID 50515
mRNA Refseq NM_001173982
Protein Refseq NP_001167453
MIM 610128
UniProt ID Q9NPF2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHST11 Products

Required fields are marked with *

My Review for All CHST11 Products

Required fields are marked with *

0
cart-icon