Recombinant Human CHST11 protein, GST-tagged
Cat.No. : | CHST11-301460H |
Product Overview : | Recombinant Human CHST11 (37-120 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Leu37-Tyr120 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | LHPVMRRNPFGVDICCRKGSRSPLQELYNPIQLELSNTAVLHQMRRDQVTDTCRANSATSRKRRVLTPNDLKHLVVDEDHELIY |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | CHST11 carbohydrate (chondroitin 4) sulfotransferase 11 [ Homo sapiens ] |
Official Symbol | CHST11 |
Synonyms | CHST11; carbohydrate (chondroitin 4) sulfotransferase 11; carbohydrate sulfotransferase 11; C4ST; C4St 1; C4ST1; HSA269537; C4S-1; IgH/CHST11 fusion; chondroitin 4-O-sulfotransferase 1; C4ST-1; FLJ41682; DKFZp667A035; |
Gene ID | 50515 |
mRNA Refseq | NM_001173982 |
Protein Refseq | NP_001167453 |
MIM | 610128 |
UniProt ID | Q9NPF2 |
◆ Recombinant Proteins | ||
CHST11-11224H | Recombinant Human CHST11, His-tagged | +Inquiry |
CHST11-301460H | Recombinant Human CHST11 protein, GST-tagged | +Inquiry |
CHST11-867R | Recombinant Rhesus monkey CHST11 Protein, His-tagged | +Inquiry |
CHST11-1063R | Recombinant Rat CHST11 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHST11-693R | Recombinant Rhesus Macaque CHST11 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHST11-001HCL | Recombinant Human CHST11 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHST11 Products
Required fields are marked with *
My Review for All CHST11 Products
Required fields are marked with *
0
Inquiry Basket