Recombinant Human CHST11 protein, GST-tagged

Cat.No. : CHST11-301460H
Product Overview : Recombinant Human CHST11 (37-120 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Leu37-Tyr120
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : LHPVMRRNPFGVDICCRKGSRSPLQELYNPIQLELSNTAVLHQMRRDQVTDTCRANSATSRKRRVLTPNDLKHLVVDEDHELIY
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name CHST11 carbohydrate (chondroitin 4) sulfotransferase 11 [ Homo sapiens ]
Official Symbol CHST11
Synonyms CHST11; carbohydrate (chondroitin 4) sulfotransferase 11; carbohydrate sulfotransferase 11; C4ST; C4St 1; C4ST1; HSA269537; C4S-1; IgH/CHST11 fusion; chondroitin 4-O-sulfotransferase 1; C4ST-1; FLJ41682; DKFZp667A035;
Gene ID 50515
mRNA Refseq NM_001173982
Protein Refseq NP_001167453
MIM 610128
UniProt ID Q9NPF2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHST11 Products

Required fields are marked with *

My Review for All CHST11 Products

Required fields are marked with *

0
cart-icon