Recombinant Human CHST13 Protein, GST-tagged
| Cat.No. : | CHST13-1340H |
| Product Overview : | Human CHST13 full-length ORF ( AAI03897.1, 1 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene belongs to the sulfotransferase 2 family. It is localized to the golgi membrane, and catalyzes the transfer of sulfate to the C4 hydroxyl of beta-1,4-linked N-acetylgalactosamine (GalNAc) flanked by glucuronic acid residue in chondroitin. Chondroitin sulfate constitutes the predominant proteoglycan present in cartilage and is distributed on the surfaces of many cells and extracellular matrices. [provided by RefSeq, Aug 2011] |
| Molecular Mass : | 51.9 kDa |
| AA Sequence : | MGRRCCRRRVLAAACLGAALLLLCAAPRSLRPAFGNRALGSSWLGGEKRSPLQKLYDLDQDPRSTLAKVHRQRRDLLNSACSRHSRRQRLLQPEDLRHVLVDDAHGLLYCYVPKVACTNWKRVLLALSGQARGDPRAISAQEAHAPGRLPSLADFSPAEINRRLRAYLAFLFVREPFERLASAYRNKLARTRSATRVASATTSWASSRRWRRTRPSCWAWRAHPT |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CHST13 carbohydrate (chondroitin 4) sulfotransferase 13 [ Homo sapiens ] |
| Official Symbol | CHST13 |
| Synonyms | CHST13; carbohydrate (chondroitin 4) sulfotransferase 13; carbohydrate sulfotransferase 13; C4ST3; C4ST-3; chondroitin 4-sulfotransferase 3; chondroitin 4-O-sulfotransferase 3; MGC119278; MGC119279; MGC119281; |
| Gene ID | 166012 |
| mRNA Refseq | NM_152889 |
| Protein Refseq | NP_690849 |
| MIM | 610124 |
| UniProt ID | Q8NET6 |
| ◆ Recombinant Proteins | ||
| CHST13-694R | Recombinant Rhesus Macaque CHST13 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CHST13-868R | Recombinant Rhesus monkey CHST13 Protein, His-tagged | +Inquiry |
| CHST13-1830HF | Recombinant Full Length Human CHST13 Protein, GST-tagged | +Inquiry |
| CHST13-1340H | Recombinant Human CHST13 Protein, GST-tagged | +Inquiry |
| CHST13-11226H | Recombinant Human CHST13, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CHST13-354HCL | Recombinant Human CHST13 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHST13 Products
Required fields are marked with *
My Review for All CHST13 Products
Required fields are marked with *



