Recombinant Full Length Human CHST13 Protein, GST-tagged

• Cat.No.: CHST13-1830HF
• Product Overview: Human CHST13 full-length ORF ( AAI03897.1, 1 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 225 amino acids
• Description: The protein encoded by this gene belongs to the sulfotransferase 2 family. It is localized to the golgi membrane, and catalyzes the transfer of sulfate to the C4 hydroxyl of beta-1,4-linked N-acetylgalactosamine (GalNAc) flanked by glucuronic acid residue in chondroitin. Chondroitin sulfate constitutes the predominant proteoglycan present in cartilage and is distributed on the surfaces of many cells and extracellular matrices. [provided by RefSeq, Aug 2011]
• Molecular Mass: 51.9 kDa
• AA Sequence: MGRRCCRRRVLAAACLGAALLLLCAAPRSLRPAFGNRALGSSWLGGEKRSPLQKLYDLDQDPRSTLAKVHRQRRDLLNSACSRHSRRQRLLQPEDLRHVLVDDAHGLLYCYVPKVACTNWKRVLLALSGQARGDPRAISAQEAHAPGRLPSLADFSPAEINRRLRAYLAFLFVREPFERLASAYRNKLARTRSATRVASATTSWASSRRWRRTRPSCWAWRAHPT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CHST13 carbohydrate (chondroitin 4) sulfotransferase 13 [ Homo sapiens ]
• Official Symbol: CHST13
• Synonyms: CHST13; carbohydrate (chondroitin 4) sulfotransferase 13; carbohydrate sulfotransferase 13; C4ST3; C4ST-3; chondroitin 4-sulfotransferase 3; chondroitin 4-O-sulfotransferase 3; MGC119278; MGC119279; MGC119281
• Gene ID: 166012
• mRNA Refseq: NM_152889
• Protein Refseq: NP_690849
• MIM: 610124
• UniProt ID: Q8NET6