Recombinant Human CHST2 Protein (AA 76-530), N-6×His/GFP tagged

Cat.No. : CHST2-01H
Product Overview : Recombinant Human CHST2 Protein (AA 76-530) with N-6×His/GFP tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : GFP&His
Protein Length : AA 76-530
Description : This locus encodes a sulfotransferase protein. The encoded enzyme catalyzes the sulfation of a nonreducing N-acetylglucosamine residue, and may play a role in biosynthesis of 6-sulfosialyl Lewis X antigen.
Molecular Mass : ~84 kDa
AA Sequence : YKWHKEPLQQCNPDGPLGAAAGAAGGSWGRPGPPPAGPPRAHARLDLRTPYRPPAAAVGAAPAAAAGMAGVAAPPGNGTRGTGGVGDKRQLVYVFTTWRSGSSFFGELFNQNPEVFFLYEPVWHVWQKLYPGDAVSLQGAARDMLSALYRCDLSVFQLYSPAGSGGRNLTTLGIFGAATNKVVCSSPLCPAYRKEVVGLVDDRVCKKCPPQRLARFEEECRKYRTLVIKGVRVFDVAVLAPLLRDPALDLKVIHLVRDPRAVASSRIRSRHGLIRESLQVVRSRDPRAHRMPFLEAAGHKLGAKKEGVGGPADYHALGAMEVICNSMAKTLQTALQPPDWLQGHYLVVRYEDLVGDPVKTLRRVYDFVGLLVSPEMEQFALNMTSGSGSSSKPFVVSARNATQAANAWRTALTFQQIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKTLLRKPRL
Purity : >95%, by SDS-PAGE under reducing conditions and visualized by Coomassie Blue stain.
Stability : 6 months if stored at -80 centigrade. Avoid repeated freeze thaws.
Concentration : 1 μg/μL
Storage Buffer : Supplied as a 0.2 μm filtered solution in 20mM HEPES and 100mM NaCl buffer, pH 7.0, with 10% Glycerol.
Preservative : 0.05 % NaN3
Shipping : This product is shipped as 0.2μm filtered product on dry ice.
Gene Name CHST2 carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2 [ Homo sapiens (human) ]
Official Symbol CHST2
Synonyms CHST2; carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2; carbohydrate sulfotransferase 2; C6ST; N-acetylglucosamine 6-O-sulfotransferase 1; carbohydrate (chondroitin 6/keratan) sulfotransferase 2; galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 2; GST2; GST-2; Gn6ST-1; glcNAc6ST-1;
Gene ID 9435
mRNA Refseq NM_004267
Protein Refseq NP_004258
MIM 603798
UniProt ID Q9Y4C5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHST2 Products

Required fields are marked with *

My Review for All CHST2 Products

Required fields are marked with *

0
cart-icon
0
compare icon