Recombinant Human CHST2 Protein (AA 76-530), N-6×His/GFP tagged
| Cat.No. : | CHST2-01H |
| Product Overview : | Recombinant Human CHST2 Protein (AA 76-530) with N-6×His/GFP tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | GFP&His |
| Protein Length : | AA 76-530 |
| Description : | This locus encodes a sulfotransferase protein. The encoded enzyme catalyzes the sulfation of a nonreducing N-acetylglucosamine residue, and may play a role in biosynthesis of 6-sulfosialyl Lewis X antigen. |
| Molecular Mass : | ~84 kDa |
| AA Sequence : | YKWHKEPLQQCNPDGPLGAAAGAAGGSWGRPGPPPAGPPRAHARLDLRTPYRPPAAAVGAAPAAAAGMAGVAAPPGNGTRGTGGVGDKRQLVYVFTTWRSGSSFFGELFNQNPEVFFLYEPVWHVWQKLYPGDAVSLQGAARDMLSALYRCDLSVFQLYSPAGSGGRNLTTLGIFGAATNKVVCSSPLCPAYRKEVVGLVDDRVCKKCPPQRLARFEEECRKYRTLVIKGVRVFDVAVLAPLLRDPALDLKVIHLVRDPRAVASSRIRSRHGLIRESLQVVRSRDPRAHRMPFLEAAGHKLGAKKEGVGGPADYHALGAMEVICNSMAKTLQTALQPPDWLQGHYLVVRYEDLVGDPVKTLRRVYDFVGLLVSPEMEQFALNMTSGSGSSSKPFVVSARNATQAANAWRTALTFQQIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKTLLRKPRL |
| Purity : | >95%, by SDS-PAGE under reducing conditions and visualized by Coomassie Blue stain. |
| Stability : | 6 months if stored at -80 centigrade. Avoid repeated freeze thaws. |
| Concentration : | 1 μg/μL |
| Storage Buffer : | Supplied as a 0.2 μm filtered solution in 20mM HEPES and 100mM NaCl buffer, pH 7.0, with 10% Glycerol. |
| Preservative : | 0.05 % NaN3 |
| Shipping : | This product is shipped as 0.2μm filtered product on dry ice. |
| Gene Name | CHST2 carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2 [ Homo sapiens (human) ] |
| Official Symbol | CHST2 |
| Synonyms | CHST2; carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2; carbohydrate sulfotransferase 2; C6ST; N-acetylglucosamine 6-O-sulfotransferase 1; carbohydrate (chondroitin 6/keratan) sulfotransferase 2; galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 2; GST2; GST-2; Gn6ST-1; glcNAc6ST-1; |
| Gene ID | 9435 |
| mRNA Refseq | NM_004267 |
| Protein Refseq | NP_004258 |
| MIM | 603798 |
| UniProt ID | Q9Y4C5 |
| ◆ Recombinant Proteins | ||
| CHST2-3451M | Recombinant Mouse CHST2 Protein | +Inquiry |
| CHST2-01H | Recombinant Human CHST2 Protein (AA 76-530), N-6×His/GFP tagged | +Inquiry |
| CHST2-1675M | Recombinant Mouse CHST2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CHST2-869R | Recombinant Rhesus monkey CHST2 Protein, His-tagged | +Inquiry |
| CHST2-695R | Recombinant Rhesus Macaque CHST2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHST2 Products
Required fields are marked with *
My Review for All CHST2 Products
Required fields are marked with *
