Recombinant Human CHST3 Protein, GST-tagged
Cat.No. : | CHST3-1343H |
Product Overview : | Human CHST3 partial ORF ( NP_004264, 312 a.a. - 411 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes an enzyme which catalyzes the sulfation of chondroitin, a proteoglycan found in the extracellular matrix and most cells which is involved in cell migration and differentiation. Mutations in this gene are associated with spondylepiphyseal dysplasia and humerospinal dysostosis. [provided by RefSeq, Mar 2009] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | VAFAGKYKTWKKWLDDEGQDGLREEEVQRLRGNCESIRLSAELGLRQPAWLRGRYMLVRYEDVARGPLQKAREMYRFAGIPLTPQVEDWIQKNTQAAHDG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHST3 carbohydrate (chondroitin 6) sulfotransferase 3 [ Homo sapiens ] |
Official Symbol | CHST3 |
Synonyms | CHST3; carbohydrate (chondroitin 6) sulfotransferase 3; carbohydrate sulfotransferase 3; C6ST; C6ST1; GST-0; C6ST-1; chondroitin 6-O-sulfotransferase 1; galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 0; HSD; |
Gene ID | 9469 |
mRNA Refseq | NM_004273 |
Protein Refseq | NP_004264 |
MIM | 603799 |
UniProt ID | Q7LGC8 |
◆ Recombinant Proteins | ||
CHST3-01H | Active Recombinant Human CHST3 Protein, His-tagged | +Inquiry |
CHST3-1343H | Recombinant Human CHST3 Protein, GST-tagged | +Inquiry |
RFL27306MF | Recombinant Full Length Mouse Carbohydrate Sulfotransferase 3(Chst3) Protein, His-Tagged | +Inquiry |
Chst3-705M | Active Recombinant Mouse Chst3 Protein, His-tagged | +Inquiry |
CHST3-352H | Active Recombinant Human CHST3, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHST3-2072MCL | Recombinant Mouse CHST3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHST3 Products
Required fields are marked with *
My Review for All CHST3 Products
Required fields are marked with *