Recombinant Human CHST3 Protein, GST-tagged

Cat.No. : CHST3-1343H
Product Overview : Human CHST3 partial ORF ( NP_004264, 312 a.a. - 411 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes an enzyme which catalyzes the sulfation of chondroitin, a proteoglycan found in the extracellular matrix and most cells which is involved in cell migration and differentiation. Mutations in this gene are associated with spondylepiphyseal dysplasia and humerospinal dysostosis. [provided by RefSeq, Mar 2009]
Molecular Mass : 36.74 kDa
AA Sequence : VAFAGKYKTWKKWLDDEGQDGLREEEVQRLRGNCESIRLSAELGLRQPAWLRGRYMLVRYEDVARGPLQKAREMYRFAGIPLTPQVEDWIQKNTQAAHDG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CHST3 carbohydrate (chondroitin 6) sulfotransferase 3 [ Homo sapiens ]
Official Symbol CHST3
Synonyms CHST3; carbohydrate (chondroitin 6) sulfotransferase 3; carbohydrate sulfotransferase 3; C6ST; C6ST1; GST-0; C6ST-1; chondroitin 6-O-sulfotransferase 1; galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 0; HSD;
Gene ID 9469
mRNA Refseq NM_004273
Protein Refseq NP_004264
MIM 603799
UniProt ID Q7LGC8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHST3 Products

Required fields are marked with *

My Review for All CHST3 Products

Required fields are marked with *

0
cart-icon