Recombinant Human CHST4 protein, His-tagged

Cat.No. : CHST4-3227H
Product Overview : Recombinant Human CHST4 protein(177-386 aa), fused with N-terminal His tag, was expressed in E.coli.
Availability December 14, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 177-386 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AASequence : DPSLNLHIVHLVRDPRAVFRSRERTKGDLMIDSRIVMGQHEQKLKKEDQPYYVMQVICQSQLEIYKTIQSLPKALQERYLLVRYEDLARAPVAQTSRMYEFVGLEFLPHLQTWVHNITRGKGMGDHAFHTNARDALNVSQAWRWSLPYEKVSRLQKACGDAMNLLGYRHVRSEQEQRNLLLDLLSTWTVPEQIH
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name CHST4 carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 4 [ Homo sapiens ]
Official Symbol CHST4
Synonyms CHST4; carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 4; carbohydrate sulfotransferase 4; HEC GLCNAC 6 ST; LSST; GST-3; gn6st-2; glcNAc6ST-2; HEC-GlcNAc6ST; L-selectin ligand sulfotransferase; N-acetylglucosamine 6-O-sulfotransferase 2; high endothelial cells N-acetylglucosamine 6-O-sulfotransferase; galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 3; galactose/N-acetylglucosamine/N-acetylgalactosamine 6-O-sulfotransferase 3; GST3; GlcNAc6ST2; HECGLCNAC6ST;
Gene ID 10164
mRNA Refseq NM_001166395
Protein Refseq NP_001159867
UniProt ID Q8NCG5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHST4 Products

Required fields are marked with *

My Review for All CHST4 Products

Required fields are marked with *

0
cart-icon
0
compare icon