Recombinant Human CHST4 protein, His-tagged

• Cat.No.: CHST4-3227H
• Product Overview: Recombinant Human CHST4 protein(177-386 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 177-386 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AASequence: DPSLNLHIVHLVRDPRAVFRSRERTKGDLMIDSRIVMGQHEQKLKKEDQPYYVMQVICQSQLEIYKTIQSLPKALQERYLLVRYEDLARAPVAQTSRMYEFVGLEFLPHLQTWVHNITRGKGMGDHAFHTNARDALNVSQAWRWSLPYEKVSRLQKACGDAMNLLGYRHVRSEQEQRNLLLDLLSTWTVPEQIH
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: CHST4 carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 4 [ Homo sapiens ]
• Official Symbol: CHST4
• Synonyms: CHST4; carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 4; carbohydrate sulfotransferase 4; HEC GLCNAC 6 ST; LSST; GST-3; gn6st-2; glcNAc6ST-2; HEC-GlcNAc6ST; L-selectin ligand sulfotransferase; N-acetylglucosamine 6-O-sulfotransferase 2; high endothelial cells N-acetylglucosamine 6-O-sulfotransferase; galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 3; galactose/N-acetylglucosamine/N-acetylgalactosamine 6-O-sulfotransferase 3; GST3; GlcNAc6ST2; HECGLCNAC6ST
• Gene ID: 10164
• mRNA Refseq: NM_001166395
• Protein Refseq: NP_001159867
• UniProt ID: Q8NCG5