Recombinant Human CHST5 Protein, GST-tagged

• Cat.No.: CHST5-1346H
• Product Overview: Human CHST5 partial ORF ( NP_036258.1, 310 a.a. - 390 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene belongs to the Gal/GalNAc/GlcNAc 6-O-sulfotransferase (GST) family, members of which catalyze the transfer of sulfate to position 6 of galactose (Gal), N-acetylgalactosamine (GalNAc), or N-acetylglucosamine (GlcNAc) residues within proteoglycans, and sulfation of O-linked sugars of mucin-type acceptors. Carbohydrate sulfation plays a critical role in many biologic processes. This gene is predominantly expressed in colon and small intestine. [provided by RefSeq, Aug 2011]
• Molecular Mass: 34.65 kDa
• AA Sequence: GSGIGKPIEAFHTSSRNARNVSQAWRHALPFTKILRVQEVCAGALQLLGYRPVYSADQQRDLTLDLVLPRGPDHFSWASPD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CHST5 carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 5 [ Homo sapiens ]
• Official Symbol: CHST5
• Synonyms: CHST5; carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 5; carbohydrate sulfotransferase 5; FLJ22167; I GLCNAC 6 ST; GST4-alpha; intestinal GlcNAc-6-sulfotransferase; N-acetylglucosamine 6-O-sulfotransferase 3; galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 4-alpha; gn6st-3; hIGn6ST; I-GlcNAc6ST; glcNAc6ST-3; I-GlcNAc-6-ST; MGC74625
• Gene ID: 23563
• mRNA Refseq: NM_024533
• Protein Refseq: NP_078809
• MIM: 604817
• UniProt ID: Q9GZS9