Recombinant Human CHST5 Protein, GST-tagged
Cat.No. : | CHST5-1346H |
Product Overview : | Human CHST5 partial ORF ( NP_036258.1, 310 a.a. - 390 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the Gal/GalNAc/GlcNAc 6-O-sulfotransferase (GST) family, members of which catalyze the transfer of sulfate to position 6 of galactose (Gal), N-acetylgalactosamine (GalNAc), or N-acetylglucosamine (GlcNAc) residues within proteoglycans, and sulfation of O-linked sugars of mucin-type acceptors. Carbohydrate sulfation plays a critical role in many biologic processes. This gene is predominantly expressed in colon and small intestine. [provided by RefSeq, Aug 2011] |
Molecular Mass : | 34.65 kDa |
AA Sequence : | GSGIGKPIEAFHTSSRNARNVSQAWRHALPFTKILRVQEVCAGALQLLGYRPVYSADQQRDLTLDLVLPRGPDHFSWASPD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHST5 carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 5 [ Homo sapiens ] |
Official Symbol | CHST5 |
Synonyms | CHST5; carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 5; carbohydrate sulfotransferase 5; FLJ22167; I GLCNAC 6 ST; GST4-alpha; intestinal GlcNAc-6-sulfotransferase; N-acetylglucosamine 6-O-sulfotransferase 3; galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 4-alpha; gn6st-3; hIGn6ST; I-GlcNAc6ST; glcNAc6ST-3; I-GlcNAc-6-ST; MGC74625; |
Gene ID | 23563 |
mRNA Refseq | NM_024533 |
Protein Refseq | NP_078809 |
MIM | 604817 |
UniProt ID | Q9GZS9 |
◆ Recombinant Proteins | ||
CHST5-1346H | Recombinant Human CHST5 Protein, GST-tagged | +Inquiry |
CHST5-3454M | Recombinant Mouse CHST5 Protein | +Inquiry |
Chst5-06M | Active Recombinant Mouse Chst5 Protein, His-tagged | +Inquiry |
Chst5-990M | Recombinant Mouse Chst5 Protein, Fc-tagged | +Inquiry |
Chst5-723M | Active Recombinant Mouse Chst5 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHST5 Products
Required fields are marked with *
My Review for All CHST5 Products
Required fields are marked with *
0
Inquiry Basket