Recombinant Human CHST5 Protein, GST-tagged

Cat.No. : CHST5-1346H
Product Overview : Human CHST5 partial ORF ( NP_036258.1, 310 a.a. - 390 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene belongs to the Gal/GalNAc/GlcNAc 6-O-sulfotransferase (GST) family, members of which catalyze the transfer of sulfate to position 6 of galactose (Gal), N-acetylgalactosamine (GalNAc), or N-acetylglucosamine (GlcNAc) residues within proteoglycans, and sulfation of O-linked sugars of mucin-type acceptors. Carbohydrate sulfation plays a critical role in many biologic processes. This gene is predominantly expressed in colon and small intestine. [provided by RefSeq, Aug 2011]
Molecular Mass : 34.65 kDa
AA Sequence : GSGIGKPIEAFHTSSRNARNVSQAWRHALPFTKILRVQEVCAGALQLLGYRPVYSADQQRDLTLDLVLPRGPDHFSWASPD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CHST5 carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 5 [ Homo sapiens ]
Official Symbol CHST5
Synonyms CHST5; carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 5; carbohydrate sulfotransferase 5; FLJ22167; I GLCNAC 6 ST; GST4-alpha; intestinal GlcNAc-6-sulfotransferase; N-acetylglucosamine 6-O-sulfotransferase 3; galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 4-alpha; gn6st-3; hIGn6ST; I-GlcNAc6ST; glcNAc6ST-3; I-GlcNAc-6-ST; MGC74625;
Gene ID 23563
mRNA Refseq NM_024533
Protein Refseq NP_078809
MIM 604817
UniProt ID Q9GZS9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHST5 Products

Required fields are marked with *

My Review for All CHST5 Products

Required fields are marked with *

0
cart-icon
0
compare icon