Recombinant Human CHST6 protein, His-tagged
Cat.No. : | CHST6-2716H |
Product Overview : | Recombinant Human CHST6 protein(211-287 aa), fused to His tag, was expressed in E. coli. |
Availability | September 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 211-287 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | REQTAKALARDNGIVLGTNGTWVEADPGLRVVREVCRSHVRIAEAATLKPPPFLRGRYRLVRFEDLAREPLAEIRAL |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CHST6 carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 6 [ Homo sapiens ] |
Official Symbol | CHST6 |
Synonyms | CHST6; carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 6; MCDC1; carbohydrate sulfotransferase 6; gn6st-5; hCGn6ST; GST4-beta; C-GlcNAc6ST; glcNAc6ST-5; N-acetylglucosamine 6-O-sulfotransferase 5; corneal N-acetylglucosamine 6-sulfotransferase; corneal N-acetylglucosamine-6-O-sulfotransferase; galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 4-beta; |
Gene ID | 4166 |
mRNA Refseq | NM_021615 |
Protein Refseq | NP_067628 |
MIM | 605294 |
UniProt ID | Q9GZX3 |
◆ Recombinant Proteins | ||
CHST6-5464C | Recombinant Chicken CHST6 | +Inquiry |
CHST6-327H | Recombinant Human CHST6 Protein, His-tagged | +Inquiry |
CHST6-738H | Active Recombinant Human CHST6 Protein, His-tagged | +Inquiry |
CHST6-1347H | Recombinant Human CHST6 Protein, GST-tagged | +Inquiry |
CHST6-2716H | Recombinant Human CHST6 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHST6-7506HCL | Recombinant Human CHST6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHST6 Products
Required fields are marked with *
My Review for All CHST6 Products
Required fields are marked with *