Recombinant Human CHST6 protein, His-tagged

Cat.No. : CHST6-2716H
Product Overview : Recombinant Human CHST6 protein(211-287 aa), fused to His tag, was expressed in E. coli.
Availability September 18, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 211-287 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : REQTAKALARDNGIVLGTNGTWVEADPGLRVVREVCRSHVRIAEAATLKPPPFLRGRYRLVRFEDLAREPLAEIRAL
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name CHST6 carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 6 [ Homo sapiens ]
Official Symbol CHST6
Synonyms CHST6; carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 6; MCDC1; carbohydrate sulfotransferase 6; gn6st-5; hCGn6ST; GST4-beta; C-GlcNAc6ST; glcNAc6ST-5; N-acetylglucosamine 6-O-sulfotransferase 5; corneal N-acetylglucosamine 6-sulfotransferase; corneal N-acetylglucosamine-6-O-sulfotransferase; galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 4-beta;
Gene ID 4166
mRNA Refseq NM_021615
Protein Refseq NP_067628
MIM 605294
UniProt ID Q9GZX3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHST6 Products

Required fields are marked with *

My Review for All CHST6 Products

Required fields are marked with *

0
cart-icon
0
compare icon