Recombinant Human CHST6 protein, His-tagged

• Cat.No.: CHST6-2716H
• Product Overview: Recombinant Human CHST6 protein(211-287 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 211-287 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: REQTAKALARDNGIVLGTNGTWVEADPGLRVVREVCRSHVRIAEAATLKPPPFLRGRYRLVRFEDLAREPLAEIRAL
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: CHST6 carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 6 [ Homo sapiens ]
• Official Symbol: CHST6
• Synonyms: CHST6; carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 6; MCDC1; carbohydrate sulfotransferase 6; gn6st-5; hCGn6ST; GST4-beta; C-GlcNAc6ST; glcNAc6ST-5; N-acetylglucosamine 6-O-sulfotransferase 5; corneal N-acetylglucosamine 6-sulfotransferase; corneal N-acetylglucosamine-6-O-sulfotransferase; galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 4-beta
• Gene ID: 4166
• mRNA Refseq: NM_021615
• Protein Refseq: NP_067628
• MIM: 605294
• UniProt ID: Q9GZX3