Recombinant Human CHSY3 protein, His-tagged
Cat.No. : | CHSY3-11236H |
Product Overview : | Recombinant Human CHSY3 protein(571-769 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | July 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 571-769 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | FFRETEELDVNSLVESINSETQSFSFISNSLKILSSFQGAKEMGGHNEKKVHILVPLIGRYDIFLRFMENFENMCLIPKQNVKLVIILFSRDSGQDSSKHIELIKGYQNKYPKAEMTLIPMKGEFSRGLGLEMASAQFDNDTLLLFCDVDLIFREDFLQRCRDNTIQGQQVYYPIIFSQYDPKVTNGGNPPTDDYFIFS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | CHSY3 |
Synonyms | CSS3; CHSY2 |
Gene ID | 337876 |
mRNA Refseq | NM_175856.4 |
Protein Refseq | NP_787052.3 |
MIM | 609963 |
UniProt ID | Q70JA7 |
◆ Recombinant Proteins | ||
CHSY3-2422H | Recombinant Human CHSY3 protein, GST-tagged | +Inquiry |
CHSY3-3459M | Recombinant Mouse CHSY3 Protein | +Inquiry |
CHSY3-11236H | Recombinant Human CHSY3 protein, His-tagged | +Inquiry |
CHSY3-1680M | Recombinant Mouse CHSY3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHSY3-785H | Recombinant Human CHSY3 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHSY3 Products
Required fields are marked with *
My Review for All CHSY3 Products
Required fields are marked with *