Recombinant Human CHSY3 protein, His-tagged
| Cat.No. : | CHSY3-11236H |
| Product Overview : | Recombinant Human CHSY3 protein(571-769 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | August 13, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 571-769 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | FFRETEELDVNSLVESINSETQSFSFISNSLKILSSFQGAKEMGGHNEKKVHILVPLIGRYDIFLRFMENFENMCLIPKQNVKLVIILFSRDSGQDSSKHIELIKGYQNKYPKAEMTLIPMKGEFSRGLGLEMASAQFDNDTLLLFCDVDLIFREDFLQRCRDNTIQGQQVYYPIIFSQYDPKVTNGGNPPTDDYFIFS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | CHSY3 |
| Synonyms | CSS3; CHSY2 |
| Gene ID | 337876 |
| mRNA Refseq | NM_175856.4 |
| Protein Refseq | NP_787052.3 |
| MIM | 609963 |
| UniProt ID | Q70JA7 |
| ◆ Recombinant Proteins | ||
| CHSY3-2422H | Recombinant Human CHSY3 protein, GST-tagged | +Inquiry |
| CHSY3-785H | Recombinant Human CHSY3 Protein, His-tagged | +Inquiry |
| CHSY3-3459M | Recombinant Mouse CHSY3 Protein | +Inquiry |
| Chsy3-786M | Recombinant Mouse Chsy3 Protein, His-tagged | +Inquiry |
| CHSY3-1680M | Recombinant Mouse CHSY3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHSY3 Products
Required fields are marked with *
My Review for All CHSY3 Products
Required fields are marked with *



