Recombinant Human CHSY3 protein, GST-tagged
| Cat.No. : | CHSY3-2422H | 
| Product Overview : | Recombinant Human CHSY3 protein(571-769 aa), fused with N-terminal GST tag, was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | GST | 
| Protein Length : | 571-769 aa | 
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. | 
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. | 
| AA Sequence : | FFRETEELDVNSLVESINSETQSFSFISNSLKILSSFQGAKEMGGHNEKKVHILVPLIGRYDIFLRFMENFENMCLIPKQNVKLVIILFSRDSGQDSSKHIELIKGYQNKYPKAEMTLIPMKGEFSRGLGLEMASAQFDNDTLLLFCDVDLIFREDFLQRCRDNTIQGQQVYYPIIFSQYDPKVTNGGNPPTDDYFIFS | 
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. | 
| Official Symbol | CHSY3 | 
| Synonyms | CSS3; CHSY2 | 
| Gene ID | 337876 | 
| mRNA Refseq | NM_175856.4 | 
| Protein Refseq | NP_787052.3 | 
| MIM | 609963 | 
| UniProt ID | Q70JA7 | 
| ◆ Recombinant Proteins | ||
| CHSY3-785H | Recombinant Human CHSY3 Protein, His-tagged | +Inquiry | 
| CHSY3-11236H | Recombinant Human CHSY3 protein, His-tagged | +Inquiry | 
| Chsy3-786M | Recombinant Mouse Chsy3 Protein, His-tagged | +Inquiry | 
| CHSY3-5503Z | Recombinant Zebrafish CHSY3 | +Inquiry | 
| CHSY3-3459M | Recombinant Mouse CHSY3 Protein | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHSY3 Products
Required fields are marked with *
My Review for All CHSY3 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            