Recombinant Human CIAPIN1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CIAPIN1-4886H |
Product Overview : | CIAPIN1 MS Standard C13 and N15-labeled recombinant protein (NP_064709) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | CIAPIN1 is a cytokine-induced inhibitor of apoptosis with no relation to apoptosis regulatory molecules of the BCL2 or CASP families. Expression of CIAPIN1 is dependent on growth factor stimulation. |
Molecular Mass : | 33.6 kDa |
AA Sequence : | MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQITGKKPNFEVGSSRQLKLSITKKSSPSVKPAVDPAAAKLWTLSANDMEDDSMDLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CIAPIN1 cytokine induced apoptosis inhibitor 1 [ Homo sapiens (human) ] |
Official Symbol | CIAPIN1 |
Synonyms | CIAPIN1; cytokine induced apoptosis inhibitor 1; anamorsin; Anamorsin; predicted protein of HQ0915; cytokine-induced apoptosis inhibitor 1; fe-S cluster assembly protein DRE2 homolog; DRE2; PRO0915; 2810413N20Rik; |
Gene ID | 57019 |
mRNA Refseq | NM_020313 |
Protein Refseq | NP_064709 |
MIM | 608943 |
UniProt ID | Q6FI81 |
◆ Recombinant Proteins | ||
CIAPIN1-7230H | Recombinant Human CIAPIN1, His-tagged | +Inquiry |
CIAPIN1-3465M | Recombinant Mouse CIAPIN1 Protein | +Inquiry |
CIAPIN1-11241H | Recombinant Human CIAPIN1, GST-tagged | +Inquiry |
CIAPIN1-4886H | Recombinant Human CIAPIN1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CIAPIN1-1354H | Recombinant Human CIAPIN1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CIAPIN1-7500HCL | Recombinant Human CIAPIN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CIAPIN1 Products
Required fields are marked with *
My Review for All CIAPIN1 Products
Required fields are marked with *