Recombinant Human CINP, His-tagged

Cat.No. : CINP-27247TH
Product Overview : Recombinant full length Human CINP with an N terminal His tag; 232 amino acids with tag, Predicted MWt 26.4 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 212 amino acids
Description : The protein encoded by this gene interacts with CDK2, MCM5, and CDC7, and is associated with the origin recognition complex protein ORC2. It acts as a homodimer and is involved in replication and ATR-mediated checkpoint signaling. Three transcript variants encoding different isoforms have been found for this gene.
Conjugation : HIS
Molecular Weight : 26.400kDa inclusive of tags
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMEAKTLGTVTPRKPVLSVSARKIKDNAADWHNLILKWETLNDAGFTTANNIANLKISLLNKDKIELDSSSPASKENEEKVCLEYNEELEKLCEELQATLDGLTKIQVKMEKLSSTTKGICELENYHYGEESKRPPLFHTWPTTHFYEVSHKLLEMYRKELLLKRTVAKELAHTGDPDLTLSYLSMWLHQPYVESDSRLHLESMLLETGHRAL
Sequence Similarities : Belongs to the CINP family.
Gene Name CINP cyclin-dependent kinase 2 interacting protein [ Homo sapiens ]
Official Symbol CINP
Synonyms CINP; cyclin-dependent kinase 2 interacting protein; cyclin-dependent kinase 2-interacting protein; MGC849;
Gene ID 51550
mRNA Refseq NM_001177612
Protein Refseq NP_001171083
MIM 613362
Uniprot ID Q9BW66
Chromosome Location 14q32.33
Function protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CINP Products

Required fields are marked with *

My Review for All CINP Products

Required fields are marked with *

0
cart-icon