Recombinant Human CINP Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CINP-3672H |
Product Overview : | CINP MS Standard C13 and N15-labeled recombinant protein (NP_116019) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is reported to be a component of the DNA replication complex as well as a genome-maintenance protein. It may interact with proteins important for replication initiation and has been shown to bind chromatin at the G1 phase of the cell cycle and dissociate from chromatin with replication initiation. It may also serve to regulate checkpoint signaling as part of the DNA damage response. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 24.3 kDa |
AA Sequence : | MEAKTLGTVTPRKPVLSVSARKIKDNAADWHNLILKWETLNDAGFTTANNIANLKISLLNKDKIELDSSSPASKENEEKVCLEYNEELEKLCEELQATLDGLTKIQVKMEKLSSTTKGICELENYHYGEESKRPPLFHTWPTTHFYEVSHKLLEMYRKELLLKRTVAKELAHTGDPDLTLSYLSMWLHQPYVESDSRLHLESMLLETGHRALTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CINP cyclin-dependent kinase 2 interacting protein [ Homo sapiens (human) ] |
Official Symbol | CINP |
Synonyms | CINP; cyclin-dependent kinase 2 interacting protein; cyclin-dependent kinase 2-interacting protein; MGC849; CDK2-interacting protein; |
Gene ID | 51550 |
mRNA Refseq | NM_032630 |
Protein Refseq | NP_116019 |
MIM | 613362 |
UniProt ID | Q9BW66 |
◆ Recombinant Proteins | ||
CINP-705R | Recombinant Rhesus Macaque CINP Protein, His (Fc)-Avi-tagged | +Inquiry |
CINP-1694M | Recombinant Mouse CINP Protein, His (Fc)-Avi-tagged | +Inquiry |
CINP-27249TH | Recombinant Human CINP | +Inquiry |
CINP-4896C | Recombinant Chicken CINP | +Inquiry |
CINP-2915H | Recombinant Human Cyclin-Dependent Kinase 2 InteractingProtein, T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CINP-7493HCL | Recombinant Human CINP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CINP Products
Required fields are marked with *
My Review for All CINP Products
Required fields are marked with *