Recombinant Human CIRBP protein, GST-tagged
Cat.No. : | CIRBP-4368H |
Product Overview : | Recombinant Human CIRBP protein(Q14011)(1-172aa), fused to N-terminal GST tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-172aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 45.6 kDa |
AA Sequence : | MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CIRBP cold inducible RNA binding protein [ Homo sapiens ] |
Official Symbol | CIRBP |
Synonyms | CIRBP; cold inducible RNA binding protein; cold-inducible RNA-binding protein; CIRP; Cold inducible RNA binding protein; glycine rich RNA binding protein; A18 hnRNP; glycine-rich RNA binding protein; cold inducible RNA-binding protein; glycine-rich RNA-binding protein CIRP; |
Gene ID | 1153 |
mRNA Refseq | NM_001280 |
Protein Refseq | NP_001271 |
MIM | 602649 |
UniProt ID | Q14011 |
◆ Recombinant Proteins | ||
Cirbp-891M | Recombinant Mouse Cirbp Protein, MYC/DDK-tagged | +Inquiry |
CIRBP-3001C | Recombinant Chicken CIRBP | +Inquiry |
CIRBP-122H | Recombinant Human CIRBP, His tagged | +Inquiry |
CIRBP-3046H | Recombinant Human Cold Inducible RNA Binding Protein, His-tagged | +Inquiry |
CIRBP-706R | Recombinant Rhesus Macaque CIRBP Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CIRBP-7491HCL | Recombinant Human CIRBP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CIRBP Products
Required fields are marked with *
My Review for All CIRBP Products
Required fields are marked with *
0
Inquiry Basket