Recombinant Human CIRBP protein, GST-tagged
| Cat.No. : | CIRBP-4368H |
| Product Overview : | Recombinant Human CIRBP protein(Q14011)(1-172aa), fused to N-terminal GST tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-172aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 45.6 kDa |
| AA Sequence : | MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CIRBP cold inducible RNA binding protein [ Homo sapiens ] |
| Official Symbol | CIRBP |
| Synonyms | CIRBP; cold inducible RNA binding protein; cold-inducible RNA-binding protein; CIRP; Cold inducible RNA binding protein; glycine rich RNA binding protein; A18 hnRNP; glycine-rich RNA binding protein; cold inducible RNA-binding protein; glycine-rich RNA-binding protein CIRP; |
| Gene ID | 1153 |
| mRNA Refseq | NM_001280 |
| Protein Refseq | NP_001271 |
| MIM | 602649 |
| UniProt ID | Q14011 |
| ◆ Recombinant Proteins | ||
| CIRBP-3001C | Recombinant Chicken CIRBP | +Inquiry |
| CIRBP-3755Z | Recombinant Zebrafish CIRBP | +Inquiry |
| CIRBP-6455HFL | Recombinant Full Length Human CIRBP protein, Flag-tagged | +Inquiry |
| CIRBP-1732H | Recombinant Human CIRBP Protein (Met1-Glu172), His tagged | +Inquiry |
| CIRBP-1695M | Recombinant Mouse CIRBP Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CIRBP-7491HCL | Recombinant Human CIRBP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CIRBP Products
Required fields are marked with *
My Review for All CIRBP Products
Required fields are marked with *
