Recombinant Human CIRBP Protein, His-tagged

• Cat.No.: CIRBP-604H
• Product Overview: Recombinant Human CIRBP Protein(NP_001271.1), fused to His-tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Form: PBS, pH 7.4.
• Molecular Mass: The protein has a calculated MW of 20 kDa.
• AA Sequence: MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNEHHHHHH
• Purity: >90%, by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.1 mg/ml

Gene Information

• Gene Name: CIRBP cold inducible RNA binding protein [ Homo sapiens (human) ]
• Official Symbol: CIRBP
• Synonyms: CIRP
• Gene ID: 1153
• mRNA Refseq: NM_001280.3
• Protein Refseq: NP_001271.1
• MIM: 602649
• UniProt ID: Q14011