Recombinant Human CIRBP Protein, His-tagged
| Cat.No. : | CIRBP-604H |
| Product Overview : | Recombinant Human CIRBP Protein(NP_001271.1), fused to His-tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Form : | PBS, pH 7.4. |
| Molecular Mass : | The protein has a calculated MW of 20 kDa. |
| AA Sequence : | MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNEHHHHHH |
| Purity : | >90%, by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.1 mg/ml |
| Gene Name | CIRBP cold inducible RNA binding protein [ Homo sapiens (human) ] |
| Official Symbol | CIRBP |
| Synonyms | CIRP |
| Gene ID | 1153 |
| mRNA Refseq | NM_001280.3 |
| Protein Refseq | NP_001271.1 |
| MIM | 602649 |
| UniProt ID | Q14011 |
| ◆ Recombinant Proteins | ||
| Cirbp-891M | Recombinant Mouse Cirbp Protein, MYC/DDK-tagged | +Inquiry |
| CIRBP-82HF | Recombinant Full Length Human CIRBP Protein | +Inquiry |
| CIRBP-27251TH | Recombinant Human CIRBP | +Inquiry |
| CIRBP-7491H | Recombinant Human CIRBP protein, MYC/DDK-tagged | +Inquiry |
| CIRBP-604H | Recombinant Human CIRBP Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CIRBP-7491HCL | Recombinant Human CIRBP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CIRBP Products
Required fields are marked with *
My Review for All CIRBP Products
Required fields are marked with *
