Recombinant Human CITED4 Protein, GST-tagged
Cat.No. : | CITED4-1388H |
Product Overview : | Human CITED4 partial ORF ( NP_597724.1, 131 a.a. - 184 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this intronless gene belongs to the CITED family of transcriptional coactivators that bind to several proteins, including CREB-binding protein (CBP) and p300, via a conserved 32 aa C-terminal motif, and regulate gene transcription. This protein also interacts with transcription factor AP2 (TFAP2), and thus may function as a co-activator for TFAP2. Hypermethylation and transcriptional downregulation of this gene has been observed in oligodendroglial tumors with deletions of chromosomal arms 1p and 19q, and associated with longer recurrence-free and overall survival of patients with oligodendroglial tumors. [provided by RefSeq, Aug 2011] |
Molecular Mass : | 31.68 kDa |
AA Sequence : | GMDAELIDEEALTSLELELGLHRVRELPELFLGQSEFDCFSDLGSAPPAGSVSC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CITED4 Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 4 [ Homo sapiens ] |
Official Symbol | CITED4 |
Synonyms | CITED4; Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 4; cbp/p300-interacting transactivator 4; transcriptional co activator 4; MRG-2; MSG1-related protein 2; transcriptional co-activator 4; |
Gene ID | 163732 |
mRNA Refseq | NM_133467 |
Protein Refseq | NP_597724 |
MIM | 606815 |
UniProt ID | Q96RK1 |
◆ Recombinant Proteins | ||
CITED4-1417R | Recombinant Rat CITED4 Protein | +Inquiry |
CITED4-1388H | Recombinant Human CITED4 Protein, GST-tagged | +Inquiry |
CITED4-1075R | Recombinant Rat CITED4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CITED4-6283C | Recombinant Chicken CITED4 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CITED4 Products
Required fields are marked with *
My Review for All CITED4 Products
Required fields are marked with *