Recombinant Human CKAP5 protein, GST-tagged
Cat.No. : | CKAP5-301363H |
Product Overview : | Recombinant Human CKAP5 (1-349 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Val349 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MGDDSEWLKLPVDQKCEHKLWKARLSGYEEALKIFQKIKDEKSPEWSKFLGLIKKFVTDSNAVVQLKGLEAALVYVENAHVAGKTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYIEIEKGEAVQEELLKGLDNKNPKIIVACIETLRKALSEFGSKIILLKPIIKVLPKLFESREKAVRDEAKLIAVEIYRWIRDALRPPLQNINSVQLKELEEEWVKLPTSAPRPTRFLRSQQELEAKLEQQQSAGGDAEGGGDDGDEVPQIDAYELLEAVEILSKLPKDFYDKIEAKKWQERKEALESVEVLIKNPKLEAGDYADLVKALKKVVGKDTNVMLVALAAKCLTGLAV |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | CKAP5 cytoskeleton associated protein 5 [ Homo sapiens ] |
Official Symbol | CKAP5 |
Synonyms | CKAP5; cytoskeleton associated protein 5; cytoskeleton-associated protein 5; ch TOG; KIAA0097; TOG; TOGp; colonic and hepatic tumor overexpressed gene protein; colonic and hepatic tumor over-expressed gene protein; MSPS; CHTOG; ch-TOG; FLJ35359; |
Gene ID | 9793 |
mRNA Refseq | NM_001008938 |
Protein Refseq | NP_001008938 |
MIM | 611142 |
UniProt ID | Q14008 |
◆ Recombinant Proteins | ||
CKAP5-6833H | Recombinant Human CKAP5 protein, His-tagged | +Inquiry |
CKAP5-1706M | Recombinant Mouse CKAP5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CKAP5-4439C | Recombinant Chicken CKAP5 | +Inquiry |
CKAP5-3493M | Recombinant Mouse CKAP5 Protein | +Inquiry |
CKAP5-3565Z | Recombinant Zebrafish CKAP5 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CKAP5 Products
Required fields are marked with *
My Review for All CKAP5 Products
Required fields are marked with *
0
Inquiry Basket