Recombinant Human CKAP5 protein, His-tagged
Cat.No. : | CKAP5-6833H |
Product Overview : | Recombinant Human CKAP5 protein(1-349 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-349 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | MGDDSEWLKLPVDQKCEHKLWKARLSGYEEALKIFQKIKDEKSPEWSKFLGLIKKFVTDSNAVVQLKGLEAALVYVENAHVAGKTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYIEIEKGEAVQEELLKGLDNKNPKIIVACIETLRKALSEFGSKIILLKPIIKVLPKLFESREKAVRDEAKLIAVEIYRWIRDALRPPLQNINSVQLKELEEEWVKLPTSAPRPTRFLRSQQELEAKLEQQQSAGGDAEGGGDDGDEVPQIDAYELLEAVEILSKLPKDFYDKIEAKKWQERKEALESVEVLIKNPKLEAGDYADLVKALKKVVGKDTNVMLVALAAKCLTGLAV |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | CKAP5 cytoskeleton associated protein 5 [ Homo sapiens ] |
Official Symbol | CKAP5 |
Synonyms | CKAP5; cytoskeleton associated protein 5; cytoskeleton-associated protein 5; ch TOG; KIAA0097; TOG; TOGp; colonic and hepatic tumor overexpressed gene protein; colonic and hepatic tumor over-expressed gene protein; MSPS; CHTOG; ch-TOG; FLJ35359; |
Gene ID | 9793 |
mRNA Refseq | NM_001008938 |
Protein Refseq | NP_001008938 |
MIM | 611142 |
UniProt ID | Q14008 |
◆ Recombinant Proteins | ||
CKAP5-791H | Recombinant Human CKAP5 Protein, His-tagged | +Inquiry |
CKAP5-4439C | Recombinant Chicken CKAP5 | +Inquiry |
CKAP5-6833H | Recombinant Human CKAP5 protein, His-tagged | +Inquiry |
CKAP5-1706M | Recombinant Mouse CKAP5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CKAP5-3493M | Recombinant Mouse CKAP5 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CKAP5 Products
Required fields are marked with *
My Review for All CKAP5 Products
Required fields are marked with *