Recombinant Human CKM Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CKM-783H |
Product Overview : | CKM MS Standard C13 and N15-labeled recombinant protein (NP_001815) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family. |
Molecular Mass : | 43.1 kDa |
AA Sequence : | MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSLLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CKM creatine kinase, M-type [ Homo sapiens (human) ] |
Official Symbol | CKM |
Synonyms | CKM; creatine kinase, muscle; CKMM; creatine kinase M-type; creatine kinase-M; creatine kinase M chain; M-CK; |
Gene ID | 1158 |
mRNA Refseq | NM_001824 |
Protein Refseq | NP_001815 |
MIM | 123310 |
UniProt ID | P06732 |
◆ Recombinant Proteins | ||
CKM-197H | Recombinant Human Creatine Kinase, Muscle, Type 1 | +Inquiry |
CKM-783H | Recombinant Human CKM Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CKM-793R | Recombinant Rabbit CKM Protein, His-tagged | +Inquiry |
CKM-1736H | Recombinant Human CKM Protein (Met1-Lys381), N-His tagged | +Inquiry |
CKM-608H | Recombinant Human CKM Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
CKM-5306H | Native Human creatine kinase, muscle | +Inquiry |
CKM-368P | Native Pig Creatine Kinase, Muscle | +Inquiry |
CKMM-382H | Native Human Creatine Kinase MM (CK-MM) | +Inquiry |
CKMM-166M | Native Mouse Creatine Kinase MM | +Inquiry |
CKM-26522TH | Native Human CKM | +Inquiry |
◆ Cell & Tissue Lysates | ||
CKM-7483HCL | Recombinant Human CKM 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CKM Products
Required fields are marked with *
My Review for All CKM Products
Required fields are marked with *