Recombinant Human CKMT1A
| Cat.No. : | CKMT1A-27113TH | 
| Product Overview : | Recombinant fragment corresponding to amino acids 327-417 of Human Creatine kinase MT with an N terminal proprietary tag; Predicted MWt 35.64 kDa. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | Non | 
| Protein Length : | 91 amino acids | 
| Description : | Mitochondrial creatine (MtCK) kinase is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Many malignant cancers with poor prognosis have shown overexpression of ubiquitous mitochondrial creatine kinase; this may be related to high energy turnover and failure to eliminate cancer cells via apoptosis. Ubiquitous mitochondrial creatine kinase has 80% homology with the coding exons of sarcomeric mitochondrial creatine kinase. Two genes located near each other on chromosome 15 have been identified which encode identical mitochondrial creatine kinase proteins. | 
| Molecular Weight : | 35.640kDa inclusive of tags | 
| Form : | Liquid | 
| Purity : | Proprietary Purification | 
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl | 
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | 
| Sequences of amino acids : | GVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH | 
| Gene Name | CKMT1A creatine kinase, mitochondrial 1A [ Homo sapiens ] | 
| Official Symbol | CKMT1A | 
| Synonyms | CKMT1A; creatine kinase, mitochondrial 1A; CKMT1, creatine kinase, mitochondrial 1 (ubiquitous); creatine kinase U-type, mitochondrial; | 
| Gene ID | 548596 | 
| mRNA Refseq | NM_001015001 | 
| Protein Refseq | NP_001015001 | 
| MIM | 613415 | 
| Uniprot ID | P12532 | 
| Chromosome Location | 15q15 | 
| Pathway | Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem; Creatine metabolism, organism-specific biosystem; Creatine pathway, organism-specific biosystem; Creatine pathway, conserved biosystem; | 
| Function | ATP binding; creatine kinase activity; nucleotide binding; | 
| ◆ Recombinant Proteins | ||
| CKMT1A-5756C | Recombinant Chicken CKMT1A | +Inquiry | 
| CKMT1A-85HF | Recombinant Full Length Human CKMT1A Protein | +Inquiry | 
| CKMT1A-1341H | Recombinant Human Creatine Kinase, Mitochondrial 1A, His-tagged | +Inquiry | 
| CKMT1A-27113TH | Recombinant Human CKMT1A | +Inquiry | 
| CKMT1A-8626H | Recombinant Human CKMT1A protein, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CKMT1A-001HCL | Recombinant Human CKMT1A cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CKMT1A Products
Required fields are marked with *
My Review for All CKMT1A Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            