Recombinant Human CKS1B Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CKS1B-3635H
Product Overview : CKS1B MS Standard C13 and N15-labeled recombinant protein (NP_001817) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : CKS1B protein binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function. The CKS1B mRNA is found to be expressed in different patterns through the cell cycle in HeLa cells, which reflects a specialized role for the encoded protein. At least two transcript variants have been identified for this gene, and it appears that only one of them encodes a protein.
Molecular Mass : 9.7 kDa
AA Sequence : MSHKQIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFRRPLPKKPKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CKS1B CDC28 protein kinase regulatory subunit 1B [ Homo sapiens (human) ]
Official Symbol CKS1B
Synonyms CKS1B; CDC28 protein kinase regulatory subunit 1B; CDC28 protein kinase 1B; cyclin-dependent kinases regulatory subunit 1; CKS1; ckshs1; CKS-1; PNAS-143; CDC28 protein kinase 1; CDC2-associated protein CKS1; cell division control protein CKS1; NB4 apoptosis/differentiation related protein; PNAS-16; PNAS-18;
Gene ID 1163
mRNA Refseq NM_001826
Protein Refseq NP_001817
MIM 116900
UniProt ID P61024

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CKS1B Products

Required fields are marked with *

My Review for All CKS1B Products

Required fields are marked with *

0
cart-icon
0
compare icon