Recombinant Human CKS1B Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CKS1B-3635H |
Product Overview : | CKS1B MS Standard C13 and N15-labeled recombinant protein (NP_001817) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | CKS1B protein binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function. The CKS1B mRNA is found to be expressed in different patterns through the cell cycle in HeLa cells, which reflects a specialized role for the encoded protein. At least two transcript variants have been identified for this gene, and it appears that only one of them encodes a protein. |
Molecular Mass : | 9.7 kDa |
AA Sequence : | MSHKQIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFRRPLPKKPKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CKS1B CDC28 protein kinase regulatory subunit 1B [ Homo sapiens (human) ] |
Official Symbol | CKS1B |
Synonyms | CKS1B; CDC28 protein kinase regulatory subunit 1B; CDC28 protein kinase 1B; cyclin-dependent kinases regulatory subunit 1; CKS1; ckshs1; CKS-1; PNAS-143; CDC28 protein kinase 1; CDC2-associated protein CKS1; cell division control protein CKS1; NB4 apoptosis/differentiation related protein; PNAS-16; PNAS-18; |
Gene ID | 1163 |
mRNA Refseq | NM_001826 |
Protein Refseq | NP_001817 |
MIM | 116900 |
UniProt ID | P61024 |
◆ Recombinant Proteins | ||
CKS1B-1868HF | Recombinant Full Length Human CKS1B Protein, GST-tagged | +Inquiry |
CKS1B-414H | Recombinant Human CDC28 protein kinase regulatory subunit 1B, His-tagged | +Inquiry |
CKS1B-3248H | Recombinant Human CKS1B Protein, MYC/DDK-tagged | +Inquiry |
Cks1b-2174M | Recombinant Mouse Cks1b Protein, Myc/DDK-tagged | +Inquiry |
CKS1B-0153H | Recombinant Human CKS1B Protein (M1-K79), Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
CKS1B-361HCL | Recombinant Human CKS1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CKS1B Products
Required fields are marked with *
My Review for All CKS1B Products
Required fields are marked with *