Recombinant Human CKS2 protein, His&Myc-tagged
| Cat.No. : | CKS2-2699H |
| Product Overview : | Recombinant Human CKS2 protein(P33552)(1-79aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 1-79aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 17.3 kDa |
| AA Sequence : | MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CKS2 CDC28 protein kinase regulatory subunit 2 [ Homo sapiens ] |
| Official Symbol | CKS2 |
| Synonyms | CKS2; CDC28 protein kinase regulatory subunit 2; CDC28 protein kinase 2; cyclin-dependent kinases regulatory subunit 2; CKS-2; CKS1(S. cerevisiae Cdc28/Cdc2 kinase subunit) homolog-2; CKSHS2; |
| Gene ID | 1164 |
| mRNA Refseq | NM_001827 |
| Protein Refseq | NP_001818 |
| MIM | 116901 |
| UniProt ID | P33552 |
| ◆ Recombinant Proteins | ||
| CKS2-26704TH | Recombinant Human CKS2, T7 -tagged | +Inquiry |
| CKS2-1404H | Recombinant Human CKS2 Protein, GST-tagged | +Inquiry |
| CKS2-1869HF | Recombinant Full Length Human CKS2 Protein, GST-tagged | +Inquiry |
| CKS2-713R | Recombinant Rhesus Macaque CKS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CKS2-0156H | Recombinant Human CKS2 Protein (M1-K79), His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CKS2-7480HCL | Recombinant Human CKS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CKS2 Products
Required fields are marked with *
My Review for All CKS2 Products
Required fields are marked with *
