Recombinant Human CKS2 protein, His&Myc-tagged
Cat.No. : | CKS2-2699H |
Product Overview : | Recombinant Human CKS2 protein(P33552)(1-79aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-79aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 17.3 kDa |
AA Sequence : | MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CKS2 CDC28 protein kinase regulatory subunit 2 [ Homo sapiens ] |
Official Symbol | CKS2 |
Synonyms | CKS2; CDC28 protein kinase regulatory subunit 2; CDC28 protein kinase 2; cyclin-dependent kinases regulatory subunit 2; CKS-2; CKS1(S. cerevisiae Cdc28/Cdc2 kinase subunit) homolog-2; CKSHS2; |
Gene ID | 1164 |
mRNA Refseq | NM_001827 |
Protein Refseq | NP_001818 |
MIM | 116901 |
UniProt ID | P33552 |
◆ Recombinant Proteins | ||
CKS2-3500M | Recombinant Mouse CKS2 Protein | +Inquiry |
CKS2-355H | Recombinant Human Cyclin-Dependent Kinases Regulatory Subunit 2, T7-Tagged | +Inquiry |
Cks2-2175M | Recombinant Mouse Cks2 Protein, Myc/DDK-tagged | +Inquiry |
CKS2-4059Z | Recombinant Zebrafish CKS2 | +Inquiry |
CKS2-4980H | Recombinant Human CKS2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CKS2-7480HCL | Recombinant Human CKS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CKS2 Products
Required fields are marked with *
My Review for All CKS2 Products
Required fields are marked with *