Recombinant Human CLASP1 Protein, GST-tagged

• Cat.No.: CLASP1-1406H
• Product Overview: Human CLASP1 partial ORF ( NP_056097, 1133 a.a. - 1226 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CLASPs, such as CLASP1, are nonmotor microtubule-associated proteins that interact with CLIPs (e.g., CLIP170; MIM 179838). CLASP1 is involved in the regulation of microtubule dynamics at the kinetochore and throughout the spindle (Maiato et al., 2003 [PubMed 12837247]).[supplied by OMIM, Mar 2008]
• Molecular Mass: 36.08 kDa
• AA Sequence: DGLAKHPPPFSQPNSIPTAPSHKALRRSYSPSMLDYDTENLNSEEIYSSLRGVTEAIEKFSFRSQEDLNEPIKRDGKKECDIVSRDGGAASPAT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CLASP1 cytoplasmic linker associated protein 1 [ Homo sapiens ]
• Official Symbol: CLASP1
• Synonyms: CLASP1; cytoplasmic linker associated protein 1; CLIP-associating protein 1; KIAA0622; MAST1; multiple asters 1; protein Orbit homolog 1; multiple asters homolog 1; cytoplasmic linker-associated protein 1; FLJ33821; FLJ41222; MGC131895; DKFZp686D1968; DKFZp686H2039
• Gene ID: 23332
• mRNA Refseq: NM_001142273
• Protein Refseq: NP_001135745
• MIM: 605852
• UniProt ID: Q7Z460