Recombinant Human CLCF1 protein

Cat.No. : CLCF1-30449TH
Product Overview : Recombinant Human CLCF1 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 198
Description : Novel Neurotrophin-1 (NNT-1) or B-Cell Stimulating Factor-3 (BSF-3), is a new member of the IL-6 family of structurally related cytokines that includes IL-6, CNTF, LIF, CT-1, IL-11 and OSM. All family members share the receptor subunit gp130 that belong to the type I cytokine receptor superfamily. Ligand binding leads to gp130 homodimerization or heterodimerization (with LIF receptor or OSM receptor beta), and induces cell signaling and functional activity. For several family members, including CNTF, IL-6, and IL-11, binding of the ligand to a specific receptor alpha subunit (CNTF R alpha, IL-6 R alpha, or IL-11 R alpha) is required prior to gp130 homo- or hetero-dimerization.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 4 ng/ml, corresponding to a specific activity of > 2.5 × 10⁵ IU/mg in the presence of human CNTF R alpha.
Molecular Mass : Approximately 22.3 kDa, a single non-glycosylated polypeptide chain containing 198 amino acids.
AA Sequence : LNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF
Endotoxin : Less than 0.1 EU/μg of rHuNNT-1/BCSF-3 as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name CLCF1
Official Symbol CLCF1
Synonyms CLCF1; cardiotrophin-like cytokine factor 1; CRLF1 associated cytokine like factor 1; B cell stimulating factor 3; BSF 3; BSF3; CISS2; CLC; cold induced sweating syndrome 2; NNT 1; NNT1; novel neurotrophin 1; NR6; novel neurotrophin-1; B-cell stimulating factor 3; B-cell stimulatory factor 3; B-cell-stimulating factor 3; CRLF1 associated cytokine-like factor 1; neurotrophin-1/B-cell stimulating factor-3; BSF-3; NNT-1;
Gene ID 23529
mRNA Refseq NM_001166212
Protein Refseq NP_001159684
MIM 607672
UniProt ID Q9UBD9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLCF1 Products

Required fields are marked with *

My Review for All CLCF1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon