Recombinant Human CLCN3 Protein, GST-tagged

Cat.No. : CLCN3-1417H
Product Overview : Human CLCN3 partial ORF ( NP_001820.2, 1 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the voltage-gated chloride channel (ClC) family. The encoded protein is present in all cell types and localized in plasma membranes and in intracellular vesicles. It is a multi-pass membrane protein which contains a ClC domain and two additional C-terminal CBS (cystathionine beta-synthase) domains. The ClC domain catalyzes the selective flow of Cl- ions across cell membranes, and the CBS domain may have a regulatory function. This protein plays a role in both acidification and transmitter loading of GABAergic synaptic vesicles, and in smooth muscle cell activation and neointima formation. This protein is required for lysophosphatidic acid (LPA)-activated Cl- current activity and fibroblast-to-myofibroblast differentiation. The protein activity is regulated by Ca(2+)/calmodulin-dependent protein kinase II (CaMKII) in glioma cells. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2011]
Molecular Mass : 36.63 kDa
AA Sequence : MESEQLFHRGYYRNSYNSITSASSDEELLDGAGVIMDFQTSEDDNLLDGDTAVGTHYTMTNGGSINSSTHLLDLLDEPIPGVGTYDDFHTIDWVREKCK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CLCN3 chloride channel, voltage-sensitive 3 [ Homo sapiens ]
Official Symbol CLCN3
Synonyms CLCN3; chloride channel, voltage-sensitive 3; chloride channel 3; H(+)/Cl(-) exchange transporter 3; ClC 3; CLC3; chloride channel protein 3; chloride transporter ClC-3; ClC-3; DKFZp564I0463;
Gene ID 1182
mRNA Refseq NM_001243372
Protein Refseq NP_001230301
MIM 600580
UniProt ID P51790

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLCN3 Products

Required fields are marked with *

My Review for All CLCN3 Products

Required fields are marked with *

0
cart-icon