Recombinant Human CLCN3 Protein, GST-tagged
Cat.No. : | CLCN3-1417H |
Product Overview : | Human CLCN3 partial ORF ( NP_001820.2, 1 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the voltage-gated chloride channel (ClC) family. The encoded protein is present in all cell types and localized in plasma membranes and in intracellular vesicles. It is a multi-pass membrane protein which contains a ClC domain and two additional C-terminal CBS (cystathionine beta-synthase) domains. The ClC domain catalyzes the selective flow of Cl- ions across cell membranes, and the CBS domain may have a regulatory function. This protein plays a role in both acidification and transmitter loading of GABAergic synaptic vesicles, and in smooth muscle cell activation and neointima formation. This protein is required for lysophosphatidic acid (LPA)-activated Cl- current activity and fibroblast-to-myofibroblast differentiation. The protein activity is regulated by Ca(2+)/calmodulin-dependent protein kinase II (CaMKII) in glioma cells. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2011] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | MESEQLFHRGYYRNSYNSITSASSDEELLDGAGVIMDFQTSEDDNLLDGDTAVGTHYTMTNGGSINSSTHLLDLLDEPIPGVGTYDDFHTIDWVREKCK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CLCN3 chloride channel, voltage-sensitive 3 [ Homo sapiens ] |
Official Symbol | CLCN3 |
Synonyms | CLCN3; chloride channel, voltage-sensitive 3; chloride channel 3; H(+)/Cl(-) exchange transporter 3; ClC 3; CLC3; chloride channel protein 3; chloride transporter ClC-3; ClC-3; DKFZp564I0463; |
Gene ID | 1182 |
mRNA Refseq | NM_001243372 |
Protein Refseq | NP_001230301 |
MIM | 600580 |
UniProt ID | P51790 |
◆ Recombinant Proteins | ||
CLCN3-1417H | Recombinant Human CLCN3 Protein, GST-tagged | +Inquiry |
CLCN3-1084R | Recombinant Rat CLCN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CLCN3-1719M | Recombinant Mouse CLCN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CLCN3-01H | Recombinant Human CLCN3 Protein, His-tagged | +Inquiry |
RFL30363HF | Recombinant Human H(+)/Cl(-) Exchange Transporter 3(Clcn3) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLCN3 Products
Required fields are marked with *
My Review for All CLCN3 Products
Required fields are marked with *
0
Inquiry Basket