Recombinant Human CLDN23 protein, His-tagged
Cat.No. : | CLDN23-3627H |
Product Overview : | Recombinant Human CLDN23 protein(184-292 aa), fused to His tag, was expressed in E. coli. |
Availability | August 17, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 184-292 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | WCDERCRRRRKGPSAGPRRSSVSTIQVEWPEPDLAPAIKYYSDGQHRPPPAQHRKPKPKPKVGFPMPRPRPKAYTNSVDVLDGEGWESQDAPSCSTHPCDSSLPCDSDL |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CLDN23 claudin 23 [ Homo sapiens ] |
Official Symbol | CLDN23 |
Synonyms | CLDN23; claudin 23; claudin-23; CLDNL; 2310014B08Rik; hCG1646163; |
Gene ID | 137075 |
mRNA Refseq | NM_194284 |
Protein Refseq | NP_919260 |
MIM | 609203 |
UniProt ID | Q96B33 |
◆ Recombinant Proteins | ||
RFL2812MF | Recombinant Full Length Mouse Claudin-23(Cldn23) Protein, His-Tagged | +Inquiry |
RFL19091HF | Recombinant Full Length Human Claudin-23(Cldn23) Protein, His-Tagged | +Inquiry |
CLDN23-11294H | Recombinant Human CLDN23, GST-tagged | +Inquiry |
CLDN23-3627H | Recombinant Human CLDN23 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLDN23-7464HCL | Recombinant Human CLDN23 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLDN23 Products
Required fields are marked with *
My Review for All CLDN23 Products
Required fields are marked with *