Recombinant Human CLDN4
| Cat.No. : | CLDN4-26708TH | 
| Product Overview : | Recombinant fragment of Human Claudin 4 (amino acids 29-78) with proprietary tag, 31.13kDa. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | Non | 
| Protein Length : | 50 amino acids | 
| Description : | This gene encodes an integral membrane protein, which belongs to the claudin family. The protein is a component of tight junction strands and may play a role in internal organ development and function during pre- and postnatal life. This gene is deleted in Williams-Beuren syndrome, a neurodevelopmental disorder affecting multiple systems. | 
| Molecular Weight : | 31.130kDa inclusive of tags | 
| Form : | Liquid | 
| Purity : | Proprietary Purification | 
| Storage buffer : | pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl | 
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | 
| Sequences of amino acids : | MWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQ | 
| Sequence Similarities : | Belongs to the claudin family. | 
| Gene Name | CLDN4 claudin 4 [ Homo sapiens ] | 
| Official Symbol | CLDN4 | 
| Synonyms | CLDN4; claudin 4; CPETR, CPETR1; claudin-4; Clostridium perfringens enterotoxin receptor 1; CPE R; hCPE R; WBSCR8; Williams Beuren syndrome chromosomal region 8 protein; | 
| Gene ID | 1364 | 
| mRNA Refseq | NM_001305 | 
| Protein Refseq | NP_001296 | 
| MIM | 602909 | 
| Uniprot ID | O14493 | 
| Chromosome Location | 7q11.23 | 
| Pathway | Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem; | 
| Function | identical protein binding; structural molecule activity; transmembrane signaling receptor activity; | 
| ◆ Recombinant Proteins | ||
| CLDN4-0392H | Active Recombinant Human CLDN4 Full Length Transmembrane protein(Nanodisc) | +Inquiry | 
| CLDN4-27272TH | Recombinant Human CLDN4 | +Inquiry | 
| RFL28924CF | Recombinant Full Length Chlorocebus Aethiops Claudin-4(Cldn4) Protein, His-Tagged | +Inquiry | 
| CLDN4-612H | Recombinant Human CLDN4 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CLDN4-722R | Recombinant Rhesus Macaque CLDN4 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ◆ Native Proteins | ||
| CLDN4-30H | Active Recombinant Full Length Human CLDN4 Protein | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CLDN4-7462HCL | Recombinant Human CLDN4 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All CLDN4 Products
Required fields are marked with *
My Review for All CLDN4 Products
Required fields are marked with *
  
        
    
      
            