Recombinant Human CLDN4
Cat.No. : | CLDN4-26708TH |
Product Overview : | Recombinant fragment of Human Claudin 4 (amino acids 29-78) with proprietary tag, 31.13kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 50 amino acids |
Description : | This gene encodes an integral membrane protein, which belongs to the claudin family. The protein is a component of tight junction strands and may play a role in internal organ development and function during pre- and postnatal life. This gene is deleted in Williams-Beuren syndrome, a neurodevelopmental disorder affecting multiple systems. |
Molecular Weight : | 31.130kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQ |
Sequence Similarities : | Belongs to the claudin family. |
Gene Name | CLDN4 claudin 4 [ Homo sapiens ] |
Official Symbol | CLDN4 |
Synonyms | CLDN4; claudin 4; CPETR, CPETR1; claudin-4; Clostridium perfringens enterotoxin receptor 1; CPE R; hCPE R; WBSCR8; Williams Beuren syndrome chromosomal region 8 protein; |
Gene ID | 1364 |
mRNA Refseq | NM_001305 |
Protein Refseq | NP_001296 |
MIM | 602909 |
Uniprot ID | O14493 |
Chromosome Location | 7q11.23 |
Pathway | Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem; |
Function | identical protein binding; structural molecule activity; transmembrane signaling receptor activity; |
◆ Recombinant Proteins | ||
CLDN4-11H | Active Recombinant Human CLDN4 Full Length Transmembrane protein, His-tagged(VLPs) | +Inquiry |
CLDN4-3538M | Recombinant Mouse CLDN4 Protein | +Inquiry |
CLDN4-2058HF | Recombinant Full Length Human CLDN4 Protein, GST-tagged | +Inquiry |
CLDN4-27272TH | Recombinant Human CLDN4 | +Inquiry |
CLDN4-1733M | Recombinant Mouse CLDN4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLDN4-7462HCL | Recombinant Human CLDN4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLDN4 Products
Required fields are marked with *
My Review for All CLDN4 Products
Required fields are marked with *
0
Inquiry Basket