Recombinant Human CLDN4

Cat.No. : CLDN4-26708TH
Product Overview : Recombinant fragment of Human Claudin 4 (amino acids 29-78) with proprietary tag, 31.13kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 50 amino acids
Description : This gene encodes an integral membrane protein, which belongs to the claudin family. The protein is a component of tight junction strands and may play a role in internal organ development and function during pre- and postnatal life. This gene is deleted in Williams-Beuren syndrome, a neurodevelopmental disorder affecting multiple systems.
Molecular Weight : 31.130kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQ
Sequence Similarities : Belongs to the claudin family.
Gene Name CLDN4 claudin 4 [ Homo sapiens ]
Official Symbol CLDN4
Synonyms CLDN4; claudin 4; CPETR, CPETR1; claudin-4; Clostridium perfringens enterotoxin receptor 1; CPE R; hCPE R; WBSCR8; Williams Beuren syndrome chromosomal region 8 protein;
Gene ID 1364
mRNA Refseq NM_001305
Protein Refseq NP_001296
MIM 602909
Uniprot ID O14493
Chromosome Location 7q11.23
Pathway Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem;
Function identical protein binding; structural molecule activity; transmembrane signaling receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLDN4 Products

Required fields are marked with *

My Review for All CLDN4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon