Recombinant Human CLDN5 protein, GST-tagged
Cat.No. : | CLDN5-15H |
Product Overview : | Recombinant Human CLDN5(1 a.a. - 218 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-218 a.a. |
Description : | This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome. Alternatively spliced transcript variants encoding the same protein have been found for this gene. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 49.5 kDa |
AA Sequence : | MGSAALEILGLVLCLVGWGGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALST EVQAARALTVSAVLLAFVALFVTLAGAQCTTCVAPGPAKARVALTGGVLYLFCGLLALVPLCWFANIVVREFYDP SVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKNYV |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | CLDN5 claudin 5 [ Homo sapiens ] |
Official Symbol | CLDN5 |
Synonyms | CLDN5; claudin 5; AWAL, TMVCF, transmembrane protein deleted in velocardiofacial syndrome; claudin-5; BEC1; CPETRL1; TMDVCF; transmembrane protein deleted in VCFS; transmembrane protein deleted in velocardiofacial syndrome; AWAL; TMVCF; |
Gene ID | 7122 |
mRNA Refseq | NM_003277 |
Protein Refseq | NP_003268 |
MIM | 602101 |
UniProt ID | O00501 |
Chromosome Location | 22q11.21 |
Pathway | Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem; Diurnally regulated genes with circadian orthologs, organism-specific biosystem; Hepatitis C, organism-specific biosystem; |
Function | identical protein binding; structural molecule activity; |
◆ Recombinant Proteins | ||
Cldn5-795M | Recombinant Mouse Cldn5 Protein, His-tagged | +Inquiry |
CLDN5-1094R | Recombinant Rat CLDN5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CLDN5-194H | Recombinant Human CLDN5 protein(Met29-Arg81), hFc-tagged | +Inquiry |
RFL24308HF | Recombinant Full Length Human Claudin-5(Cldn5) Protein, His-Tagged | +Inquiry |
RFL8771MF | Recombinant Full Length Mouse Claudin-5(Cldn5) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLDN5-7461HCL | Recombinant Human CLDN5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLDN5 Products
Required fields are marked with *
My Review for All CLDN5 Products
Required fields are marked with *