Recombinant Human CLDN6 Transmembrane protein (1-82 aa), His-SUMO-tagged

Cat.No. : CLDN6-2711H
Product Overview : Recombinant Human CLDN6 Protein (1-82 aa) is produced by in vitro E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-82aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 24.8kDa
AA Sequence : MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARA
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name CLDN6 claudin 6 [ Homo sapiens ]
Official Symbol CLDN6
Synonyms CLDN6; claudin 6; claudin-6; skullin;
Gene ID 9074
mRNA Refseq NM_021195
Protein Refseq NP_067018
UniProt ID P56747

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLDN6 Products

Required fields are marked with *

My Review for All CLDN6 Products

Required fields are marked with *

0
cart-icon