Recombinant Human CLDN6 Transmembrane protein (1-82 aa), His-SUMO-tagged
| Cat.No. : | CLDN6-2711H |
| Product Overview : | Recombinant Human CLDN6 Protein (1-82 aa) is produced by in vitro E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-82aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 24.8kDa |
| AA Sequence : | MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CLDN6 claudin 6 [ Homo sapiens ] |
| Official Symbol | CLDN6 |
| Synonyms | CLDN6; claudin 6; claudin-6; skullin; |
| Gene ID | 9074 |
| mRNA Refseq | NM_021195 |
| Protein Refseq | NP_067018 |
| UniProt ID | P56747 |
| ◆ Recombinant Proteins | ||
| CLDN6-861M | Active Recombinant Mouse CLDN6 Full Length Transmembrane protein(VLPs) | +Inquiry |
| CLDN6-835H | Active Recombinant Human CLDN6 protein, His-Twin-Strep-tagged(Nanodisc) | +Inquiry |
| CLDN6-0193H | Recombinant Human CLDN6 Full Length Transmembrane protein, GFP-tagged | +Inquiry |
| CLDN6-29378H | Active Recombinant Human CLDN6 Full Length Transmembrane protein(VLPs) | +Inquiry |
| CLDN6-137H | Recombinant Human CLDN6 protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CLDN6-7460HCL | Recombinant Human CLDN6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLDN6 Products
Required fields are marked with *
My Review for All CLDN6 Products
Required fields are marked with *
