Recombinant Human CLDN7 Protein, GST-tagged

Cat.No. : CLDN7-1446H
Product Overview : Human CLDN7 full-length ORF ( NP_001298.2, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. Differential expression of this gene has been observed in different types of malignancies, including breast cancer, ovarian cancer, hepatocellular carcinomas, urinary tumors, prostate cancer, lung cancer, head and neck cancers, thyroid carcinomas, etc.. Alternatively spliced transcript variants encoding different isoforms have been found.[provided by RefSeq, May 2010]
Molecular Mass : 48.8 kDa
AA Sequence : MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAMGGGIIFIVAGLATLVACSWYGHQIVTDFYNPLIPTNIKYEFGPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRAPRSYPKSNSSKEYV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CLDN7 claudin 7 [ Homo sapiens ]
Official Symbol CLDN7
Synonyms CLDN7; claudin 7; CEPTRL2, CPETRL2; claudin-7; Hs.84359; clostridium perfringens enterotoxin receptor-like 2; CLDN-7; CEPTRL2; CPETRL2; claudin-1;
Gene ID 1366
mRNA Refseq NM_001185022
Protein Refseq NP_001171951
MIM 609131
UniProt ID O95471

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLDN7 Products

Required fields are marked with *

My Review for All CLDN7 Products

Required fields are marked with *

0
cart-icon