Recombinant Human CLDN8 Protein, GST-tagged
Cat.No. : | CLDN8-1448H |
Product Overview : | Human CLDN8 full-length ORF ( NP_955360.1, 1 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. This protein plays important roles in the paracellular cation barrier of the distal renal tubule, and in the paracellular barrier to prevent sodium back-leakage in distal colon. Differential expression of this gene has been observed in colorectal carcinoma and renal cell tumors, and along with claudin-7, is an immunohistochemical marker for the differential diagnosis of chromophobe renal cell carcinoma and renal oncocytoma.[provided by RefSeq, May 2010] |
Molecular Mass : | 51.2 kDa |
AA Sequence : | MATHALEIAGLFLGGVGMVGTVAVTVMPQWRVSAFIENNIVVFENFWEGLWMNCVRQANIRMQCKIYDSLLALSPDLQAARGLMCAASVMSFLAFMMAILGMKCTRCTGDNEKVKAHILLTAGIIFIITGMVVLIPVSWVANAIIRDFYNSIVNVAQKRELGEALYLGWTTALVLIVGGALFCCVFCCNEKSSSYRYSIPSHRTTQKSYHTGKKSPSVYSRSQYV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CLDN8 claudin 8 [ Homo sapiens ] |
Official Symbol | CLDN8 |
Synonyms | CLDN8; claudin 8; claudin-8; |
Gene ID | 9073 |
mRNA Refseq | NM_199328 |
Protein Refseq | NP_955360 |
MIM | 611231 |
UniProt ID | P56748 |
◆ Recombinant Proteins | ||
CLDN8-2063HF | Recombinant Full Length Human CLDN8 Protein, GST-tagged | +Inquiry |
CLDN8-723R | Recombinant Rhesus Macaque CLDN8 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL20665HF | Recombinant Full Length Human Claudin-8(Cldn8) Protein, His-Tagged | +Inquiry |
CLDN8-1075Z | Recombinant Zebrafish CLDN8 | +Inquiry |
CLDN8-1448H | Recombinant Human CLDN8 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLDN8-7458HCL | Recombinant Human CLDN8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLDN8 Products
Required fields are marked with *
My Review for All CLDN8 Products
Required fields are marked with *